(data stored in ACNUC7421 zone)

EMBL: CP002299.PE195

CP002299.PE195       Location/Qualifiers
FT   CDS             complement(262502..263467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0195"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   sgr:SGR_1541 putative nucleoside-diphosphate-sugar
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78283"
FT                   /db_xref="GOA:E3J4W4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4W4"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ADP78283.1"
FT                   /translation="MSGLLDQGSVFVAGHRGLVGSAITRRLRGAGIDVITRGREELDLT
FT                   DTVAVSRFFDEVRPGAVVLAAAKVGGIMANATQPVEFLENNLHIQLNVISSAWRAGTEK
FT                   LLFLGSSCIYPKFAAQPITEDALLTGPLEPTNEAYAIAKIAGITQIQSYRREYGAHYVS
FT                   AMPTNVYGPGDNFDLETSHVLPALIHRFHLATERGDSEVTLWGSGTPRREFIHVDDLAD
FT                   ACATILEKYDDPAPINVGTGTDVTIRELAELVADVVGFTGTINFDPAKPDGTPRKLLDV
FT                   SKLEGLGWKPSISLRDGIESTFAWWKSSGQVARGRVTVDA"
     MSGLLDQGSV FVAGHRGLVG SAITRRLRGA GIDVITRGRE ELDLTDTVAV SRFFDEVRPG        60
     AVVLAAAKVG GIMANATQPV EFLENNLHIQ LNVISSAWRA GTEKLLFLGS SCIYPKFAAQ       120
     PITEDALLTG PLEPTNEAYA IAKIAGITQI QSYRREYGAH YVSAMPTNVY GPGDNFDLET       180
     SHVLPALIHR FHLATERGDS EVTLWGSGTP RREFIHVDDL ADACATILEK YDDPAPINVG       240
     TGTDVTIREL AELVADVVGF TGTINFDPAK PDGTPRKLLD VSKLEGLGWK PSISLRDGIE       300
     STFAWWKSSG QVARGRVTVD A                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page