(data stored in ACNUC7421 zone)

EMBL: CP002299.PE2

CP002299.PE2         Location/Qualifiers
FT   CDS             2876..4039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: fal:FRAAL0004 DNA
FT                   polymerase III, beta chain; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78090"
FT                   /db_xref="GOA:E3J252"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E3J252"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ADP78090.1"
FT                   /translation="MKFRVERDEFTEAVAWTARSLPSRSATATNQQVLMGLLLDATGPG
FT                   LVVAAFDYEVAAQATLEATVHEEGRALAPGRMLADITKQLPAAPVEVETDDNKLVITCG
FT                   NARFTLQTLPVDEYPTLPPLPPITGHIEGGAFGAAVAQVAVAAGKDDTLPVLTGVRLEI
FT                   EGDTLTLAATDRYRLAVRTLKWSPSSPDAAGVALIPARTLLDTARSLGGGTAQVAIALG
FT                   TGPSGEALAGFAGNHRQTTTRLVDGQFPPYRKLLPDSCPLTAQAEKGPLLEAVKRVALV
FT                   APKTAPVRLAFSADHLRLEAGSHGGEAQASETLPATYDGPDLEVAFNPAYLQDALTAVE
FT                   SDQVEFGFASAEDAEVAAKKPAILTGKGAGDELPDYRYLLMPIQLNG"
     MKFRVERDEF TEAVAWTARS LPSRSATATN QQVLMGLLLD ATGPGLVVAA FDYEVAAQAT        60
     LEATVHEEGR ALAPGRMLAD ITKQLPAAPV EVETDDNKLV ITCGNARFTL QTLPVDEYPT       120
     LPPLPPITGH IEGGAFGAAV AQVAVAAGKD DTLPVLTGVR LEIEGDTLTL AATDRYRLAV       180
     RTLKWSPSSP DAAGVALIPA RTLLDTARSL GGGTAQVAIA LGTGPSGEAL AGFAGNHRQT       240
     TTRLVDGQFP PYRKLLPDSC PLTAQAEKGP LLEAVKRVAL VAPKTAPVRL AFSADHLRLE       300
     AGSHGGEAQA SETLPATYDG PDLEVAFNPA YLQDALTAVE SDQVEFGFAS AEDAEVAAKK       360
     PAILTGKGAG DELPDYRYLL MPIQLNG                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page