(data stored in ACNUC7421 zone)

EMBL: CP002299.PE20

CP002299.PE20        Location/Qualifiers
FT   CDS             25064..25411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0020"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ara:Arad_0352 adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78108"
FT                   /db_xref="UniProtKB/TrEMBL:E3J270"
FT                   /inference="similar to AA sequence:KEGG:Arad_0352"
FT                   /protein_id="ADP78108.1"
FT                   /translation="MSGRAVKSRTRLSSHLSVCGGASVHLNVYPERSPILTLTTGDVSV
FT                   TIAMSTTDLDGTAMQFVRELADAAARFAEDCARFALNADPDAGPAAGPVNPPTGLASPP
FT                   SVGRSRGSRAA"
     MSGRAVKSRT RLSSHLSVCG GASVHLNVYP ERSPILTLTT GDVSVTIAMS TTDLDGTAMQ        60
     FVRELADAAA RFAEDCARFA LNADPDAGPA AGPVNPPTGL ASPPSVGRSR GSRAA            115
//

If you have problems or comments...

PBIL Back to PBIL home page