(data stored in ACNUC7421 zone)

EMBL: CP002299.PE200

CP002299.PE200       Location/Qualifiers
FT   CDS             complement(268785..270068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0200"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="SMART: adenylosuccinate synthetase; TIGRFAM:
FT                   adenylosuccinate synthetase; KEGG: fal:FRAAL6660
FT                   adenylosuccinate synthetase; PFAM: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78288"
FT                   /db_xref="GOA:E3J4W9"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:E3J4W9"
FT                   /inference="protein motif:TFAM:TIGR00184"
FT                   /protein_id="ADP78288.1"
FT                   /translation="MPALVLIGAQWGDEGKGKATDLLGGAVDYVVRYQGGNNAGHTVVI
FT                   GAEKYALHLIPSGILRPDCVPVIGNGVVIDPGVLLAEMAGLRARGIDTSRLLISASAHL
FT                   IMPHHRALDRVTERYLGKARIGTTGRGIGPAYGDKVARTGIRVQDLLDPGILRQKLELA
FT                   LREKNQVLAKVYNRRKIEVDAVVAEYLDYASQLGPHIADTGLVLDTALRAGKVVLLEGS
FT                   QGTLLDVDHGTYPFVTSSNPTAGGAATGAGIGPTRISRVIGIIKAYTTRVGSGPFPTEL
FT                   DDKVGDELRRIGGEFGVTTGRARRTGWYDAVIARYAVRVNGLTDLFLTKLDVLSGFDTV
FT                   PVCVAYDVGGTRMAEMPMTQTEFHHAKPIYEEFPGWHEDISEATSFDQLPPEARDYVRA
FT                   LEEMSGAPISAIGVGPGRDQTLVLRDLL"
     MPALVLIGAQ WGDEGKGKAT DLLGGAVDYV VRYQGGNNAG HTVVIGAEKY ALHLIPSGIL        60
     RPDCVPVIGN GVVIDPGVLL AEMAGLRARG IDTSRLLISA SAHLIMPHHR ALDRVTERYL       120
     GKARIGTTGR GIGPAYGDKV ARTGIRVQDL LDPGILRQKL ELALREKNQV LAKVYNRRKI       180
     EVDAVVAEYL DYASQLGPHI ADTGLVLDTA LRAGKVVLLE GSQGTLLDVD HGTYPFVTSS       240
     NPTAGGAATG AGIGPTRISR VIGIIKAYTT RVGSGPFPTE LDDKVGDELR RIGGEFGVTT       300
     GRARRTGWYD AVIARYAVRV NGLTDLFLTK LDVLSGFDTV PVCVAYDVGG TRMAEMPMTQ       360
     TEFHHAKPIY EEFPGWHEDI SEATSFDQLP PEARDYVRAL EEMSGAPISA IGVGPGRDQT       420
     LVLRDLL                                                                 427
//

If you have problems or comments...

PBIL Back to PBIL home page