(data stored in ACNUC7421 zone)

EMBL: CP002299.PE205

CP002299.PE205       Location/Qualifiers
FT   CDS             276234..276953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0205"
FT                   /product="SNARE associated Golgi protein-like protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   fal:FRAAL6654 putative integral membrane protein (partial
FT                   match)"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78293"
FT                   /db_xref="GOA:E3J602"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:E3J602"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ADP78293.1"
FT                   /translation="MDVDHLSGLTLYLTVFAIVFLESGVPIGFWLPGDAMLFATGLMAA
FT                   NPAHRISLPVLAAGVTVMAVAGVCLGYVTGRRLGRPWLERRHRKVLDRTETFYDRFGPV
FT                   TLIAARFVPWARTFAPILAGAVRMPPARFLVAAAVGALVWGTGIPALGYAASSVPGLKD
FT                   ATGWLAPAVVALSLAAGVPGELLRRRARRNRAATDLAVAEPTEPDGSTDPAVETPGAVR
FT                   PGSDGSTAFAGAERGPA"
     MDVDHLSGLT LYLTVFAIVF LESGVPIGFW LPGDAMLFAT GLMAANPAHR ISLPVLAAGV        60
     TVMAVAGVCL GYVTGRRLGR PWLERRHRKV LDRTETFYDR FGPVTLIAAR FVPWARTFAP       120
     ILAGAVRMPP ARFLVAAAVG ALVWGTGIPA LGYAASSVPG LKDATGWLAP AVVALSLAAG       180
     VPGELLRRRA RRNRAATDLA VAEPTEPDGS TDPAVETPGA VRPGSDGSTA FAGAERGPA        239
//

If you have problems or comments...

PBIL Back to PBIL home page