(data stored in ACNUC7421 zone)

EMBL: CP002299.PE209

CP002299.PE209       Location/Qualifiers
FT   CDS             complement(280883..281614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0209"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cne:CNF00590 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78297"
FT                   /db_xref="UniProtKB/TrEMBL:E3J606"
FT                   /inference="similar to AA sequence:KEGG:CNF00590"
FT                   /protein_id="ADP78297.1"
FT                   /translation="MLSIRVTSRRFQATAAAVALAFSAALAGCSAGSDSAAGTPAPSVA
FT                   SESTAKLDPMDYIYTQGPETAGFKLDQSSAGAGDPTSHDDAIFLDIDGCLGKNVGAPTA
FT                   VATGPTLTSQDGFTSVDSNAEIVTTAQRAAHLQELKDPRLDGCIKKLMGQSSGSGASQD
FT                   ETIKSLTWRTAPVPAGALARVAYTGQVTASGAKTSVYLDVVFLGAGRVENEVALFSAIR
FT                   PPDETLVSAVTAQLAAKLKSQ"
     MLSIRVTSRR FQATAAAVAL AFSAALAGCS AGSDSAAGTP APSVASESTA KLDPMDYIYT        60
     QGPETAGFKL DQSSAGAGDP TSHDDAIFLD IDGCLGKNVG APTAVATGPT LTSQDGFTSV       120
     DSNAEIVTTA QRAAHLQELK DPRLDGCIKK LMGQSSGSGA SQDETIKSLT WRTAPVPAGA       180
     LARVAYTGQV TASGAKTSVY LDVVFLGAGR VENEVALFSA IRPPDETLVS AVTAQLAAKL       240
     KSQ                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page