(data stored in ACNUC7421 zone)

EMBL: CP002299.PE210

CP002299.PE210       Location/Qualifiers
FT   CDS             complement(281759..283954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0210"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6646 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78298"
FT                   /db_xref="GOA:E3J607"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:E3J607"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6646"
FT                   /protein_id="ADP78298.1"
FT                   /translation="MRWSRDSAQSAQQAARRHRHRVERLAEWPIGRCGRWVAVVLWLAL
FT                   ALVATPLAGRLGNAQTNDAAAFLPPNAESTQVLAAQRQLPGGDAIPAVVVFTRPTGRLT
FT                   AADQAAMKAAGAQLAPFAAAPVTPAAPAPDGRAALMIVPVAQSANADAFADEINRMRAV
FT                   VRKLAPPGLQTSVTGPAGVIVDTYTSFRGVETPLLFVTAAVVAVILLVVYRGPFLCLVP
FT                   LVAVGAADQAATAIIYLLARHGGLTVNGQSAGILRVLVFGAGTDYALLLIARYREELTR
FT                   HAAATEAMRVALLRAGPAVLASAGTVVLSLLCLLLGELNSDRGLGPVGAVGIAVAFLTM
FT                   GTLLPALLVICGRRLFWPQIPRIAAPAVTTSLKDAGNPDVVGAWARAGLLIARRPRPIW
FT                   LVTSAVLAGLTVGIVTFHIGLTDRGAFRHPIDSIIGEERIAAHFPLGASAPTFVIGASD
FT                   SAARLGDVIDATPGVATAVVDGTGAGLTQFLVVLRDPPDSAAAAATIDRLRARVRPVPG
FT                   ADALVGGTTAVNHDIAQAAMRDRQLVIPLVLVVVLVILGLLLRAAVAPLVLILTVVLSF
FT                   LASLGVSALVFRGVFHFAGADPSLPLFGFIFLVALGVDYNIFLMTRVREEAMHTDARTG
FT                   VLRGLAVTGGVITSAGVVLAATFSVLFIFPLVQLAEIGFLVAFGVLLDTLVVRSILVPA
FT                   LALDLGRVMWWPSRLSRPPTPPADLLAPDVVVSEDVP"
     MRWSRDSAQS AQQAARRHRH RVERLAEWPI GRCGRWVAVV LWLALALVAT PLAGRLGNAQ        60
     TNDAAAFLPP NAESTQVLAA QRQLPGGDAI PAVVVFTRPT GRLTAADQAA MKAAGAQLAP       120
     FAAAPVTPAA PAPDGRAALM IVPVAQSANA DAFADEINRM RAVVRKLAPP GLQTSVTGPA       180
     GVIVDTYTSF RGVETPLLFV TAAVVAVILL VVYRGPFLCL VPLVAVGAAD QAATAIIYLL       240
     ARHGGLTVNG QSAGILRVLV FGAGTDYALL LIARYREELT RHAAATEAMR VALLRAGPAV       300
     LASAGTVVLS LLCLLLGELN SDRGLGPVGA VGIAVAFLTM GTLLPALLVI CGRRLFWPQI       360
     PRIAAPAVTT SLKDAGNPDV VGAWARAGLL IARRPRPIWL VTSAVLAGLT VGIVTFHIGL       420
     TDRGAFRHPI DSIIGEERIA AHFPLGASAP TFVIGASDSA ARLGDVIDAT PGVATAVVDG       480
     TGAGLTQFLV VLRDPPDSAA AAATIDRLRA RVRPVPGADA LVGGTTAVNH DIAQAAMRDR       540
     QLVIPLVLVV VLVILGLLLR AAVAPLVLIL TVVLSFLASL GVSALVFRGV FHFAGADPSL       600
     PLFGFIFLVA LGVDYNIFLM TRVREEAMHT DARTGVLRGL AVTGGVITSA GVVLAATFSV       660
     LFIFPLVQLA EIGFLVAFGV LLDTLVVRSI LVPALALDLG RVMWWPSRLS RPPTPPADLL       720
     APDVVVSEDV P                                                            731
//

If you have problems or comments...

PBIL Back to PBIL home page