(data stored in ACNUC7421 zone)

EMBL: CP002299.PE215

CP002299.PE215       Location/Qualifiers
FT   CDS             complement(287839..290109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0215"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: fal:FRAAL6636
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78303"
FT                   /db_xref="GOA:E3J612"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:E3J612"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ADP78303.1"
FT                   /translation="MALRIAIGGAITLIALAIAGRRFFWLFRLIQTGQPAEGRLDDIPT
FT                   RIWSEVSEVGGQRKLLKWSVPGLAHAFTFWGFTVLILTIIETFGGLFDEDFHIPWFGHW
FT                   AGIGFIEDFFAVAVLAGLATFAVIRVKRAPARLERKSRFYGSHLGPAWVILGMITAVIV
FT                   TLLITRGAQWNTGNLPQGKTKWAFASYAVSRVFSPLGHTANDAIETTFLLINLAIIMGF
FT                   LVLVAYSKHLHIFLAPINVVLKREPKALGALGTTPDIETLMEQDEPIIGAGKVEDFSWK
FT                   AMLDFSTCTECGRCQSQCPAWNTGKPLSPKLVIMDLRDHLFAKAPYLLGGTDTESRDAA
FT                   WDAAVAKAHEGHDHAPGEGHDHGDHDEHEVHGVPESGFARVAEPGKAQAERPLVGTAEE
FT                   GGVIDPDVLWSCTNCGACVEQCPVDIEHVDHIVDMRRYQVMIESAFPSEAGVMLRNLEN
FT                   NGNPWGVSPRSRTEWTDGLPFEVKVIGEGEQIPEDVEYLFWVGCAGAIEDRAKKVSRAF
FT                   AELLDMAGVKFAILGSQESCTGDPARRLGNEYLFQEMAKANIELLNETGVKKIVATCPH
FT                   CFNSLSKEYSGLGGNYEVVHHTQLLGKLVEEKKLVPITPIESSVTYHDPCFLGRHNKVY
FT                   TPPREILEAIPGLRGQEMHRCKDRGFCCGAGGARMWMEEKIGTRINANRVEEALGLDPD
FT                   VVSTACPFCIVMLSDAVTEQKLAGTAKESVEVLDVSQLLARSLAAPAAPTQDAPGAEPA
FT                   PMS"
     MALRIAIGGA ITLIALAIAG RRFFWLFRLI QTGQPAEGRL DDIPTRIWSE VSEVGGQRKL        60
     LKWSVPGLAH AFTFWGFTVL ILTIIETFGG LFDEDFHIPW FGHWAGIGFI EDFFAVAVLA       120
     GLATFAVIRV KRAPARLERK SRFYGSHLGP AWVILGMITA VIVTLLITRG AQWNTGNLPQ       180
     GKTKWAFASY AVSRVFSPLG HTANDAIETT FLLINLAIIM GFLVLVAYSK HLHIFLAPIN       240
     VVLKREPKAL GALGTTPDIE TLMEQDEPII GAGKVEDFSW KAMLDFSTCT ECGRCQSQCP       300
     AWNTGKPLSP KLVIMDLRDH LFAKAPYLLG GTDTESRDAA WDAAVAKAHE GHDHAPGEGH       360
     DHGDHDEHEV HGVPESGFAR VAEPGKAQAE RPLVGTAEEG GVIDPDVLWS CTNCGACVEQ       420
     CPVDIEHVDH IVDMRRYQVM IESAFPSEAG VMLRNLENNG NPWGVSPRSR TEWTDGLPFE       480
     VKVIGEGEQI PEDVEYLFWV GCAGAIEDRA KKVSRAFAEL LDMAGVKFAI LGSQESCTGD       540
     PARRLGNEYL FQEMAKANIE LLNETGVKKI VATCPHCFNS LSKEYSGLGG NYEVVHHTQL       600
     LGKLVEEKKL VPITPIESSV TYHDPCFLGR HNKVYTPPRE ILEAIPGLRG QEMHRCKDRG       660
     FCCGAGGARM WMEEKIGTRI NANRVEEALG LDPDVVSTAC PFCIVMLSDA VTEQKLAGTA       720
     KESVEVLDVS QLLARSLAAP AAPTQDAPGA EPAPMS                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page