(data stored in ACNUC7421 zone)

EMBL: CP002299.PE222

CP002299.PE222       Location/Qualifiers
FT   CDS             297243..298010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0222"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78310"
FT                   /db_xref="UniProtKB/TrEMBL:E3J619"
FT                   /inference="similar to AA sequence:KEGG:Sked_00700"
FT                   /protein_id="ADP78310.1"
FT                   /translation="MHGQGWGRRLRRGACVGVAATAMAVLAAGCQSGGDPTIAPAPEVT
FT                   SAVTTPVVTTPPATPPQDLKATDYVLTAGPETDGFDGSGGADEDTTDPAARARIAACVG
FT                   VPDYNPAEPFDRSSGDTFVGQQDQMTQASSQAKILSAAQVRQDASIVTNPRFADCMRAE
FT                   LVSSIGDKPIGGETYKILSVRSLSHPDGITAFFRTTMEVSNADTTQRFFMDVAYFYVGQ
FT                   VAVELDFQNFDSPMPASTEQAMAAQITDKLTDQ"
     MHGQGWGRRL RRGACVGVAA TAMAVLAAGC QSGGDPTIAP APEVTSAVTT PVVTTPPATP        60
     PQDLKATDYV LTAGPETDGF DGSGGADEDT TDPAARARIA ACVGVPDYNP AEPFDRSSGD       120
     TFVGQQDQMT QASSQAKILS AAQVRQDASI VTNPRFADCM RAELVSSIGD KPIGGETYKI       180
     LSVRSLSHPD GITAFFRTTM EVSNADTTQR FFMDVAYFYV GQVAVELDFQ NFDSPMPAST       240
     EQAMAAQITD KLTDQ                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page