(data stored in ACNUC7421 zone)

EMBL: CP002299.PE227

CP002299.PE227       Location/Qualifiers
FT   CDS             304197..305009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0227"
FT                   /product="beta-phosphoglucomutase family hydrolase"
FT                   /note="KEGG: fal:FRAAL6634 glucose-1-phosphate
FT                   phosphodismutase; beta-phosphoglucomutase; TIGRFAM:
FT                   beta-phosphoglucomutase family hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IA, variant 3; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78315"
FT                   /db_xref="GOA:E3J624"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E3J624"
FT                   /inference="protein motif:TFAM:TIGR02009"
FT                   /protein_id="ADP78315.1"
FT                   /translation="MLGLPDHIDAVLFDLDGVLTSTAEVHARAWKEMFDDFLDDWARRS
FT                   GDPEEPFDIDRDYEQYVDGKPRLDGVRSFLASRDIHLPEGAADDPPSGLTVNALGTRKN
FT                   ILVLDKIAKDGVQAYPGTMRYLRACVAAGKHRALVSSSANAGAVAESAGFADLLEARVD
FT                   GLTIDERGLAGKPAPDTFLAAARELGVPPERAAVFEDAEAGVAAGRAGKFGFVVGVDRV
FT                   GRGHADALRAHGADIVVGDLADLLSGDPAPGTPPTGTGRTDGTSGSAQ"
     MLGLPDHIDA VLFDLDGVLT STAEVHARAW KEMFDDFLDD WARRSGDPEE PFDIDRDYEQ        60
     YVDGKPRLDG VRSFLASRDI HLPEGAADDP PSGLTVNALG TRKNILVLDK IAKDGVQAYP       120
     GTMRYLRACV AAGKHRALVS SSANAGAVAE SAGFADLLEA RVDGLTIDER GLAGKPAPDT       180
     FLAAARELGV PPERAAVFED AEAGVAAGRA GKFGFVVGVD RVGRGHADAL RAHGADIVVG       240
     DLADLLSGDP APGTPPTGTG RTDGTSGSAQ                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page