(data stored in ACNUC7421 zone)

EMBL: CP002299.PE228

CP002299.PE228       Location/Qualifiers
FT   CDS             305006..307375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0228"
FT                   /product="glycoside hydrolase family 65 central catalytic"
FT                   /note="PFAM: glycoside hydrolase family 65 central
FT                   catalytic; glycoside hydrolase family 65 domain protein;
FT                   KEGG: fal:FRAAL6633 putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78316"
FT                   /db_xref="GOA:E3J625"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:E3J625"
FT                   /inference="protein motif:PFAM:PF03632"
FT                   /protein_id="ADP78316.1"
FT                   /translation="MNEQATYTVDPWGLREIGFDAEDPARSESLFSLSNGHIGLRGNLD
FT                   EGEPHGLPGTYLNSVHELRPLPYAEAGYGYPESGQTVINVTNGKLIRLMVDDEPLDVRY
FT                   GELRSHRRSLDFRDGVLVRQAEWESPAGQVVRVTSRRLVSFSQRAVAAICYEVESLTDS
FT                   PRVVVQSELVANETLPARIGDPRAAAVLESPLIPELNFARDTTVELVHVTRHSQMRVAA
FT                   AMDHVIDGPGSIGVLSECEPNSGRVTVTGILKPGQKLRIVKFLAYGWSQQRSLPAMRDQ
FT                   AAAALVAARATGWEGLLDEQREYLDAFWKRADVEVDGDAEVQQAVRFALFHVLQAGARS
FT                   ERRAIPAKGLTGPGYDGHAFWDTESYVLPVLTYTSPGAAADALRWRHSTLKLAQERAQL
FT                   LNLKGAAFPWRTISGEECSGYWPAGTAAFHVNADIADAVSRYVNVTEDFEFERAVGLEL
FT                   LVETARLWRSLGHHDLDGKFRIDGVTGPDEYSAIADNNVYTNLMAQKNLRAAADAARRH
FT                   PDRAKEFGVDSEETASWRDAAEDMYIPFDENLGVHPQSDGFTGHELWDFERTRPEQYPL
FT                   LLHFPYFDLYRKQVVKQADLVLAMQRRGDAFTPEQKVRNFAYYEGLCVRDSSLSAAPQG
FT                   VMAAECGHLALAHAYLREAALMDLHDIEHNTSDGLHMASLAGSWIALVEGFGGLRDHGS
FT                   VLAFNPRLSEGLSRLAFGLCVRGRHLRVEVTNSAATYTVQEGEGITLTHHGERFHVEPN
FT                   LPLTLNIPPAPRREHPRQPAGREPRFFHTPTDPEDD"
     MNEQATYTVD PWGLREIGFD AEDPARSESL FSLSNGHIGL RGNLDEGEPH GLPGTYLNSV        60
     HELRPLPYAE AGYGYPESGQ TVINVTNGKL IRLMVDDEPL DVRYGELRSH RRSLDFRDGV       120
     LVRQAEWESP AGQVVRVTSR RLVSFSQRAV AAICYEVESL TDSPRVVVQS ELVANETLPA       180
     RIGDPRAAAV LESPLIPELN FARDTTVELV HVTRHSQMRV AAAMDHVIDG PGSIGVLSEC       240
     EPNSGRVTVT GILKPGQKLR IVKFLAYGWS QQRSLPAMRD QAAAALVAAR ATGWEGLLDE       300
     QREYLDAFWK RADVEVDGDA EVQQAVRFAL FHVLQAGARS ERRAIPAKGL TGPGYDGHAF       360
     WDTESYVLPV LTYTSPGAAA DALRWRHSTL KLAQERAQLL NLKGAAFPWR TISGEECSGY       420
     WPAGTAAFHV NADIADAVSR YVNVTEDFEF ERAVGLELLV ETARLWRSLG HHDLDGKFRI       480
     DGVTGPDEYS AIADNNVYTN LMAQKNLRAA ADAARRHPDR AKEFGVDSEE TASWRDAAED       540
     MYIPFDENLG VHPQSDGFTG HELWDFERTR PEQYPLLLHF PYFDLYRKQV VKQADLVLAM       600
     QRRGDAFTPE QKVRNFAYYE GLCVRDSSLS AAPQGVMAAE CGHLALAHAY LREAALMDLH       660
     DIEHNTSDGL HMASLAGSWI ALVEGFGGLR DHGSVLAFNP RLSEGLSRLA FGLCVRGRHL       720
     RVEVTNSAAT YTVQEGEGIT LTHHGERFHV EPNLPLTLNI PPAPRREHPR QPAGREPRFF       780
     HTPTDPEDD                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page