(data stored in ACNUC7421 zone)

EMBL: CP002299.PE229

CP002299.PE229       Location/Qualifiers
FT   CDS             308160..308558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0229"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL2948 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78317"
FT                   /db_xref="GOA:E3J626"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:E3J626"
FT                   /inference="similar to AA sequence:KEGG:FRAAL2948"
FT                   /protein_id="ADP78317.1"
FT                   /translation="MAMMADGVRALSFTRHAVGSMRELPVQRAVFTAACEAHGWSAGGS
FT                   VCQIGRGLRAWWSVVRMVRSGAYDVVVVDTWERMSATEAGQLWVLALLQRSGVRLLVAR
FT                   DGIDTGDPVGHGLGCALLDIWGREAVAR"
     MAMMADGVRA LSFTRHAVGS MRELPVQRAV FTAACEAHGW SAGGSVCQIG RGLRAWWSVV        60
     RMVRSGAYDV VVVDTWERMS ATEAGQLWVL ALLQRSGVRL LVARDGIDTG DPVGHGLGCA       120
     LLDIWGREAV AR                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page