(data stored in ACNUC7421 zone)

EMBL: CP002299.PE234

CP002299.PE234       Location/Qualifiers
FT   CDS             complement(313314..314477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0236"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   sfu:Sfum_4009 radical SAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78322"
FT                   /db_xref="GOA:E3J631"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E3J631"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADP78322.1"
FT                   /translation="MPYRLIASPFLDHHLLVTPGSNQGVKISPDRYQALQTLDTEDGDV
FT                   PVWLTAAAKQRWGIDLAGAIAGSVLVRQPTALNYGRASHEVNLGCNYDCEHCYLGLKKF
FT                   DGLEWDDRVRLLHTIRDAGVLWLQLTGGEPMIDRHFSDVYALAFDLGMMIDVLSNGSRL
FT                   ANPGILDLLTRRPPHRITLSIYGATEASYDGLTRRRGAFKAFSAGLAAAHEAGIPMDLS
FT                   IGVTRSNAHEVDQMRALADRYGLPHSLYGNISPTIYGGAEVLASQAPEILGPRTPFTGC
FT                   NAGHTFFHVDPFGKASICKVGREPNIPLLDEGLDGLARLGTIADGLLQRQGGCTGCTLQ
FT                   GTCGTCMPLVTLFRKANAPLRNYCQHKETPHGRRQLHVVHPDRAATH"
     MPYRLIASPF LDHHLLVTPG SNQGVKISPD RYQALQTLDT EDGDVPVWLT AAAKQRWGID        60
     LAGAIAGSVL VRQPTALNYG RASHEVNLGC NYDCEHCYLG LKKFDGLEWD DRVRLLHTIR       120
     DAGVLWLQLT GGEPMIDRHF SDVYALAFDL GMMIDVLSNG SRLANPGILD LLTRRPPHRI       180
     TLSIYGATEA SYDGLTRRRG AFKAFSAGLA AAHEAGIPMD LSIGVTRSNA HEVDQMRALA       240
     DRYGLPHSLY GNISPTIYGG AEVLASQAPE ILGPRTPFTG CNAGHTFFHV DPFGKASICK       300
     VGREPNIPLL DEGLDGLARL GTIADGLLQR QGGCTGCTLQ GTCGTCMPLV TLFRKANAPL       360
     RNYCQHKETP HGRRQLHVVH PDRAATH                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page