(data stored in ACNUC7421 zone)

EMBL: CP002299.PE241

CP002299.PE241       Location/Qualifiers
FT   CDS             complement(321268..321693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0243"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV_5688 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78329"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="UniProtKB/TrEMBL:E3J638"
FT                   /inference="similar to AA sequence:KEGG:SAV_5688"
FT                   /protein_id="ADP78329.1"
FT                   /translation="MLTLNRSVVSTDTDYGTALLDERSGRYWTLNPTAALALRVLLDGG
FT                   DPPQAARALLDQYDVAPATARADVDKLVDDLQAAGLITGSVSGSGIEPPAGTTPPASGG
FT                   SATGASAAGGQHRSGTRARHALRSALGRSSRPRTSDR"
     MLTLNRSVVS TDTDYGTALL DERSGRYWTL NPTAALALRV LLDGGDPPQA ARALLDQYDV        60
     APATARADVD KLVDDLQAAG LITGSVSGSG IEPPAGTTPP ASGGSATGAS AAGGQHRSGT       120
     RARHALRSAL GRSSRPRTSD R                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page