(data stored in ACNUC7421 zone)

EMBL: CP002299.PE244

CP002299.PE244       Location/Qualifiers
FT   CDS             complement(324495..325316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0246"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="PFAM: transcriptional activator domain;
FT                   transcriptional regulator domain-containing protein; KEGG:
FT                   fal:FRAAL4923 putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78332"
FT                   /db_xref="GOA:E3J641"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E3J641"
FT                   /inference="protein motif:PFAM:PF03704"
FT                   /protein_id="ADP78332.1"
FT                   /translation="MDVDVEPGTGVVRFAALGPLELLAADGAPVFIGQRKKRRLLALLL
FT                   LHAGGWVSTEQIAVALWEDDPPRSALGNIKTYVSELRRALPPASGDRTDGHDADPGSPF
FT                   GRILSRDGEYLLRLAPNEFDIELFDAGACAGEEALAAGRPAEATVLLDRALALWRGQPY
FT                   DDLPADIAVAETSRLDELRWAVWENLVDARLRLGQHNRVLPALRALTIQHPTRERLWAQ
FT                   LLAALGQDGRRAEALNAYQTVYRMLTERLGIEPGEDLRLEHQRILNGDQHR"
     MDVDVEPGTG VVRFAALGPL ELLAADGAPV FIGQRKKRRL LALLLLHAGG WVSTEQIAVA        60
     LWEDDPPRSA LGNIKTYVSE LRRALPPASG DRTDGHDADP GSPFGRILSR DGEYLLRLAP       120
     NEFDIELFDA GACAGEEALA AGRPAEATVL LDRALALWRG QPYDDLPADI AVAETSRLDE       180
     LRWAVWENLV DARLRLGQHN RVLPALRALT IQHPTRERLW AQLLAALGQD GRRAEALNAY       240
     QTVYRMLTER LGIEPGEDLR LEHQRILNGD QHR                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page