(data stored in ACNUC7421 zone)

EMBL: CP002299.PE245

CP002299.PE245       Location/Qualifiers
FT   CDS             325619..326518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0247"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="PFAM: glutamine amidotransferase class-II; KEGG:
FT                   fal:FRAAL6624 putative glucosamine--fructose-6-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78333"
FT                   /db_xref="GOA:E3J642"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E3J642"
FT                   /inference="protein motif:PFAM:PF00310"
FT                   /protein_id="ADP78333.1"
FT                   /translation="MCQMFALTSGSQPVEATFWLLDSPDSERALSARVPDGAGLATFGE
FT                   DRAPRIVKQPISSRAGADFAYQPRTVVSSTFIAHVRHASTGRTSLANTHPFQHAGRVFA
FT                   HNGVIEELDRLDDQLGEYRGLVQGDTDSERYFALINREIDAQGGDVGAGIVAAARWIAA
FT                   NLPLYSINMVMATADELWALRYPDTNRLYVLSREPGGQNSRHLDHASPFSEIRARSLDL
FT                   ADRPAVAVESERMDEDPAWRLMASGELLHVAADLTVTSRVVISIPPARQLSLDDLSPEA
FT                   AFSQVVNVAPAETTPTSA"
     MCQMFALTSG SQPVEATFWL LDSPDSERAL SARVPDGAGL ATFGEDRAPR IVKQPISSRA        60
     GADFAYQPRT VVSSTFIAHV RHASTGRTSL ANTHPFQHAG RVFAHNGVIE ELDRLDDQLG       120
     EYRGLVQGDT DSERYFALIN REIDAQGGDV GAGIVAAARW IAANLPLYSI NMVMATADEL       180
     WALRYPDTNR LYVLSREPGG QNSRHLDHAS PFSEIRARSL DLADRPAVAV ESERMDEDPA       240
     WRLMASGELL HVAADLTVTS RVVISIPPAR QLSLDDLSPE AAFSQVVNVA PAETTPTSA        299
//

If you have problems or comments...

PBIL Back to PBIL home page