(data stored in ACNUC7421 zone)

EMBL: CP002299.PE247

CP002299.PE247       Location/Qualifiers
FT   CDS             complement(328470..329240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0249"
FT                   /product="Xre family DNA-binding protein"
FT                   /note="KEGG: rer:RER_33300 Xre family DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78335"
FT                   /db_xref="GOA:E3J644"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="UniProtKB/TrEMBL:E3J644"
FT                   /inference="similar to AA sequence:KEGG:RER_33300"
FT                   /protein_id="ADP78335.1"
FT                   /translation="MTQDAAPRPLREVVGEAARKIRETAKRRQDDVARGARLMGLPWSR
FT                   AKVGALENGAKAVSVEELVTLALVLTQVCGRTIRVPDLLDADDLVILTPHLQVPAREVA
FT                   KSLAGQNSLGALDPAIALTPAGHKAVLAEVESLAREKRANAELFLLVTRIQRLGLKGDL
FT                   DAWAAEIGEAEQKTARRLDEPAVVLVALSHELWGRTLSEERDRVADEREPDASPDRRRA
FT                   LRGQVTRALVNELAAELARRDHIAAPVGTDGTDR"
     MTQDAAPRPL REVVGEAARK IRETAKRRQD DVARGARLMG LPWSRAKVGA LENGAKAVSV        60
     EELVTLALVL TQVCGRTIRV PDLLDADDLV ILTPHLQVPA REVAKSLAGQ NSLGALDPAI       120
     ALTPAGHKAV LAEVESLARE KRANAELFLL VTRIQRLGLK GDLDAWAAEI GEAEQKTARR       180
     LDEPAVVLVA LSHELWGRTL SEERDRVADE REPDASPDRR RALRGQVTRA LVNELAAELA       240
     RRDHIAAPVG TDGTDR                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page