(data stored in ACNUC7421 zone)

EMBL: CP002299.PE248

CP002299.PE248       Location/Qualifiers
FT   CDS             329378..329569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0250"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: gob:Gobs_1452 transcriptional regulator, MerR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78336"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E3J645"
FT                   /inference="similar to AA sequence:KEGG:Gobs_1452"
FT                   /protein_id="ADP78336.1"
FT                   /translation="MTEELMTSRQVSEFLNVPAATLRTWRLRGSGPQSFRLCGTVRYRR
FT                   SVVEAWLAEQEQAGQVGR"
     MTEELMTSRQ VSEFLNVPAA TLRTWRLRGS GPQSFRLCGT VRYRRSVVEA WLAEQEQAGQ        60
     VGR                                                                      63
//

If you have problems or comments...

PBIL Back to PBIL home page