(data stored in ACNUC7421 zone)

EMBL: CP002299.PE25

CP002299.PE25        Location/Qualifiers
FT   CDS             29741..30049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0025"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1736 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78113"
FT                   /db_xref="InterPro:IPR023817"
FT                   /db_xref="UniProtKB/TrEMBL:E3J275"
FT                   /inference="similar to AA sequence:KEGG:FRAAL1736"
FT                   /protein_id="ADP78113.1"
FT                   /translation="MHIFSSGDPELWRTPETGPALVLVTLLPTGECEVTIHPGADVEDV
FT                   TAALAVVPAGAVFVEHFNDVEAVLLFRRNPAGPPAPEIVPWVPVSPLVPTAAGVSRP"
     MHIFSSGDPE LWRTPETGPA LVLVTLLPTG ECEVTIHPGA DVEDVTAALA VVPAGAVFVE        60
     HFNDVEAVLL FRRNPAGPPA PEIVPWVPVS PLVPTAAGVS RP                          102
//

If you have problems or comments...

PBIL Back to PBIL home page