(data stored in ACNUC7421 zone)

EMBL: CP002299.PE255

CP002299.PE255       Location/Qualifiers
FT   CDS             332389..332820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0257"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: sro:Sros_1853 hypothetical protein; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78343"
FT                   /db_xref="GOA:E3J652"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E3J652"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADP78343.1"
FT                   /translation="MTACRPVTPRARGRVGGTGAGEAGPDGMPHRGRTDVFEAAFLRDG
FT                   FGAALRSARQRRGWSRRTLAGRSGVSWSAVRALETGVRRPRAVTVRYLAAALALADPAP
FT                   LAAELLGLAGESLRPDTAGAVRQRRRASPRAVALRACGR"
     MTACRPVTPR ARGRVGGTGA GEAGPDGMPH RGRTDVFEAA FLRDGFGAAL RSARQRRGWS        60
     RRTLAGRSGV SWSAVRALET GVRRPRAVTV RYLAAALALA DPAPLAAELL GLAGESLRPD       120
     TAGAVRQRRR ASPRAVALRA CGR                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page