(data stored in ACNUC7421 zone)

EMBL: CP002299.PE260

CP002299.PE260       Location/Qualifiers
FT   CDS             337429..337947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bfa:Bfae_28240 galactokinase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78348"
FT                   /db_xref="UniProtKB/TrEMBL:E3J657"
FT                   /inference="similar to AA sequence:KEGG:Bfae_28240"
FT                   /protein_id="ADP78348.1"
FT                   /translation="MATEGFPGGVDSVKSWLADLFGEEPGRSLWTVLDGPLRLALAQGW
FT                   ILGTSGSRADDLAEELAAADSSHRRFPAMLAALADHWRRVYADLRDGAGVVNLNLLAGA
FT                   DMEAVVLTGQEYGDQVVRQVVGHVFITRLDGDGWHIAALSRKLPIPGWPPTEQEISGLE
FT                   VTSRPLGHA"
     MATEGFPGGV DSVKSWLADL FGEEPGRSLW TVLDGPLRLA LAQGWILGTS GSRADDLAEE        60
     LAAADSSHRR FPAMLAALAD HWRRVYADLR DGAGVVNLNL LAGADMEAVV LTGQEYGDQV       120
     VRQVVGHVFI TRLDGDGWHI AALSRKLPIP GWPPTEQEIS GLEVTSRPLG HA               172
//

If you have problems or comments...

PBIL Back to PBIL home page