(data stored in ACNUC7421 zone)

EMBL: CP002299.PE262

CP002299.PE262       Location/Qualifiers
FT   CDS             complement(338223..339185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL1350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78350"
FT                   /db_xref="UniProtKB/TrEMBL:E3J659"
FT                   /inference="similar to AA sequence:KEGG:FRAAL1350"
FT                   /protein_id="ADP78350.1"
FT                   /translation="MAPSSTPRPARRAVVVAGALTAAGVALPTASGGSDLRDQLGDAIG
FT                   QTRAAWELLPPITVVDACQHWAHLAEGRPGDDWAALRGQVALLHARALADIGETHPALD
FT                   RAEAARKYARQIGDPQTHAWATLVAAEVHDAAQPGSVVPMRMAAIAAERAGKSWVGVHA
FT                   AVVRACLIGRAGEPGMARVVDAATDADQLVGTLADPTPGEFTAPQAFAFIAVALTRVGM
FT                   FVPARRRLADVADAFSPRSQPGMASAIAIWQAGTELAAGDVLTAGAHAARAVDIAQDRP
FT                   TAWLADSILAQNTRAGGQGGYGKVTARVAGWPSTLTGPV"
     MAPSSTPRPA RRAVVVAGAL TAAGVALPTA SGGSDLRDQL GDAIGQTRAA WELLPPITVV        60
     DACQHWAHLA EGRPGDDWAA LRGQVALLHA RALADIGETH PALDRAEAAR KYARQIGDPQ       120
     THAWATLVAA EVHDAAQPGS VVPMRMAAIA AERAGKSWVG VHAAVVRACL IGRAGEPGMA       180
     RVVDAATDAD QLVGTLADPT PGEFTAPQAF AFIAVALTRV GMFVPARRRL ADVADAFSPR       240
     SQPGMASAIA IWQAGTELAA GDVLTAGAHA ARAVDIAQDR PTAWLADSIL AQNTRAGGQG       300
     GYGKVTARVA GWPSTLTGPV                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page