(data stored in ACNUC7421 zone)

EMBL: CP002299.PE266

CP002299.PE266       Location/Qualifiers
FT   CDS             342047..343300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL2921 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78354"
FT                   /db_xref="UniProtKB/TrEMBL:E3J663"
FT                   /inference="similar to AA sequence:KEGG:FRAAL2921"
FT                   /protein_id="ADP78354.1"
FT                   /translation="MQLADAASYTSRYLTDVLSGRSVPSVKVVATLERVLAAGGELVAL
FT                   REQAAREQVARRHGLSIPEQTFPAAPRAGSSGAVDVWSPDGAVWTKGPGEEADVDQDRR
FT                   EFLSLAAIVALAGQVSDDIATADPTPRTLDRMEADADELSAQIYDLPTPVLLGRAASQW
FT                   HAAHVLLDRPVSAPVRARLLMVAGAVSCRAAFLGRRTGDLTIQRHFGVLAGQYADESGD
FT                   PLLIGQVAGLRSRTAFSAKQYAKAAALAAAGLNTAHPTQRARLAAYQAEALAAAGRAGE
FT                   ARTALDTMYAESRRTTFRWTTGDQLIFGAVTLSTLGEHRPAADLADAYITGGEFDGEGV
FT                   GWAHVTIGQALFAADRPDPAAAAHHGRLALAATPDADLSVITRVADLHTHLRQAAAGDS
FT                   EVAELGQALAGARASLTA"
     MQLADAASYT SRYLTDVLSG RSVPSVKVVA TLERVLAAGG ELVALREQAA REQVARRHGL        60
     SIPEQTFPAA PRAGSSGAVD VWSPDGAVWT KGPGEEADVD QDRREFLSLA AIVALAGQVS       120
     DDIATADPTP RTLDRMEADA DELSAQIYDL PTPVLLGRAA SQWHAAHVLL DRPVSAPVRA       180
     RLLMVAGAVS CRAAFLGRRT GDLTIQRHFG VLAGQYADES GDPLLIGQVA GLRSRTAFSA       240
     KQYAKAAALA AAGLNTAHPT QRARLAAYQA EALAAAGRAG EARTALDTMY AESRRTTFRW       300
     TTGDQLIFGA VTLSTLGEHR PAADLADAYI TGGEFDGEGV GWAHVTIGQA LFAADRPDPA       360
     AAAHHGRLAL AATPDADLSV ITRVADLHTH LRQAAAGDSE VAELGQALAG ARASLTA          417
//

If you have problems or comments...

PBIL Back to PBIL home page