(data stored in ACNUC7421 zone)

EMBL: CP002299.PE267

CP002299.PE267       Location/Qualifiers
FT   CDS             complement(343459..345570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0269"
FT                   /product="cell division protein FtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG: sna:Snas_0972
FT                   cell division FtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78355"
FT                   /db_xref="GOA:E3J664"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J664"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ADP78355.1"
FT                   /translation="MTEPDAGTVTPPGGLLVAGPWAAADAPDEEHTPVAVDQAPAVELD
FT                   GRPWEVPPDRRPVVAPWVRDVRQLRRVAWWAAGEALHPVAFHAARLPLYTGRLAAGSPR
FT                   GAARSAATVARWALDAGGAERLGDVDRKDTPAYLALSAQRDARLRRRLPLVGVSLLAGG
FT                   IGDAVLYTKEPTVFGLTTAAGVLALGAVGRRRDRPLLDSPTTVSGRAPKLTSDIVERAL
FT                   AHCGLPADIAKKITANGLEWVAPIAIDGPGWRAEFDLPYGVTVAEVAEHRDKLASGLRR
FT                   PLGAVWPEPESDAHPGRMVLWVGKDTLAKSKAPAWPLLNRGQADIFAPLPFGFDQRLRP
FT                   VSVPLIFDSILIGAMPRYGKTMALRVLLLGAALDPSVLLYIYELKGTGDLSSPGEQVAH
FT                   RYASGAGNATLAACMDGLREVHAELERRADIIRGLPKSVCPENKVTPELSRRPGSGLAP
FT                   ILFSIDECQELFSSKEHKDEATELAVAIMKRGPALGIILALATQRPSRDSLPLDISANI
FT                   GIRLCLRVAGHVENNMILGTGMSARGVQAYTFTRRDKGIAYLAGVEDDPIVVRGAYLDA
FT                   PAAERVADRARAIRAAAGLLTGHAAGEVVERDEDTPFAFLADAVQVAEDRTHLAVLAGR
FT                   LADGWPERYTTAAGEPWTAQQIGAQLRTAGVEVEPQMWATGTKGTATNAVGVTRDAIRQ
FT                   AIAARSGQA"
     MTEPDAGTVT PPGGLLVAGP WAAADAPDEE HTPVAVDQAP AVELDGRPWE VPPDRRPVVA        60
     PWVRDVRQLR RVAWWAAGEA LHPVAFHAAR LPLYTGRLAA GSPRGAARSA ATVARWALDA       120
     GGAERLGDVD RKDTPAYLAL SAQRDARLRR RLPLVGVSLL AGGIGDAVLY TKEPTVFGLT       180
     TAAGVLALGA VGRRRDRPLL DSPTTVSGRA PKLTSDIVER ALAHCGLPAD IAKKITANGL       240
     EWVAPIAIDG PGWRAEFDLP YGVTVAEVAE HRDKLASGLR RPLGAVWPEP ESDAHPGRMV       300
     LWVGKDTLAK SKAPAWPLLN RGQADIFAPL PFGFDQRLRP VSVPLIFDSI LIGAMPRYGK       360
     TMALRVLLLG AALDPSVLLY IYELKGTGDL SSPGEQVAHR YASGAGNATL AACMDGLREV       420
     HAELERRADI IRGLPKSVCP ENKVTPELSR RPGSGLAPIL FSIDECQELF SSKEHKDEAT       480
     ELAVAIMKRG PALGIILALA TQRPSRDSLP LDISANIGIR LCLRVAGHVE NNMILGTGMS       540
     ARGVQAYTFT RRDKGIAYLA GVEDDPIVVR GAYLDAPAAE RVADRARAIR AAAGLLTGHA       600
     AGEVVERDED TPFAFLADAV QVAEDRTHLA VLAGRLADGW PERYTTAAGE PWTAQQIGAQ       660
     LRTAGVEVEP QMWATGTKGT ATNAVGVTRD AIRQAIAARS GQA                         703
//

If you have problems or comments...

PBIL Back to PBIL home page