(data stored in ACNUC7421 zone)

EMBL: CP002299.PE27

CP002299.PE27        Location/Qualifiers
FT   CDS             30567..31760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0027"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: sti:Sthe_2831
FT                   integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78115"
FT                   /db_xref="GOA:E3J277"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E3J277"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ADP78115.1"
FT                   /translation="MAEQKNEPDGAASAEEKKSRRAHGEGGLYQRASDNRWVGVVDLGW
FT                   IDGKRRRRTVYGRTQKEARGKMNALREAAGKGQDLAAKPQTVAEWLSYWLDEIKGHDGT
FT                   RPSTLSRYRYAIDGHIVPVLGKIRLDKLSPADVRRLHAARRDSMKPASLAKIHAVLRVA
FT                   LADAERMDLVSRNVAKSVQPPKLGDSDPRDLAVEDARRFLEVAAGDRLEALFVVALTMG
FT                   LRRGELLGLRWDDVDLDAATLRVVRSAQRVSGTLRLVDTKTRGSRRPVPIPAMTLEALK
FT                   RHRKRQDQERADAGKAWKENGLVFASTVGTLIEPRNVTRRVQQLRGRVNLPTLRLHDFR
FT                   HACASFLLAAGIEPRTVMEILGHATMRMTMERYGHALPERLRAASDAMDKLMGQRLP"
     MAEQKNEPDG AASAEEKKSR RAHGEGGLYQ RASDNRWVGV VDLGWIDGKR RRRTVYGRTQ        60
     KEARGKMNAL REAAGKGQDL AAKPQTVAEW LSYWLDEIKG HDGTRPSTLS RYRYAIDGHI       120
     VPVLGKIRLD KLSPADVRRL HAARRDSMKP ASLAKIHAVL RVALADAERM DLVSRNVAKS       180
     VQPPKLGDSD PRDLAVEDAR RFLEVAAGDR LEALFVVALT MGLRRGELLG LRWDDVDLDA       240
     ATLRVVRSAQ RVSGTLRLVD TKTRGSRRPV PIPAMTLEAL KRHRKRQDQE RADAGKAWKE       300
     NGLVFASTVG TLIEPRNVTR RVQQLRGRVN LPTLRLHDFR HACASFLLAA GIEPRTVMEI       360
     LGHATMRMTM ERYGHALPER LRAASDAMDK LMGQRLP                                397
//

If you have problems or comments...

PBIL Back to PBIL home page