(data stored in ACNUC7421 zone)

EMBL: CP002299.PE272

CP002299.PE272       Location/Qualifiers
FT   CDS             complement(347306..347626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0274"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce8916 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78360"
FT                   /db_xref="UniProtKB/TrEMBL:E3J669"
FT                   /inference="similar to AA sequence:KEGG:sce8916"
FT                   /protein_id="ADP78360.1"
FT                   /translation="MNALCTRPSSAAEAYAKANAALFALLDDPDVERAAGAADAVEQLH
FT                   ELFAQAAPPAPREPYEPYLTWLASLGDVPSLRYRAGAGDVLTVFASLMAELRAARPEAG
FT                   DR"
     MNALCTRPSS AAEAYAKANA ALFALLDDPD VERAAGAADA VEQLHELFAQ AAPPAPREPY        60
     EPYLTWLASL GDVPSLRYRA GAGDVLTVFA SLMAELRAAR PEAGDR                      106
//

If you have problems or comments...

PBIL Back to PBIL home page