(data stored in ACNUC7421 zone)

EMBL: CP002299.PE273

CP002299.PE273       Location/Qualifiers
FT   CDS             complement(347623..348084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mac:MA3833 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78361"
FT                   /db_xref="GOA:E3J670"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:E3J670"
FT                   /inference="similar to AA sequence:KEGG:MA3833"
FT                   /protein_id="ADP78361.1"
FT                   /translation="MTILDTRPAAAPADPFAALDSFGADTDEMAARFAAVVADFTPAPA
FT                   ATCLGCGRRITAAASVARGYGEGCWRRARRRAALLAGSFSDRQVEQAVEAVEDGAIVPA
FT                   ETPRAWLVVSSKGDEVYQTDGAACDCPAGQSGRICWHLASVALVERAAA"
     MTILDTRPAA APADPFAALD SFGADTDEMA ARFAAVVADF TPAPAATCLG CGRRITAAAS        60
     VARGYGEGCW RRARRRAALL AGSFSDRQVE QAVEAVEDGA IVPAETPRAW LVVSSKGDEV       120
     YQTDGAACDC PAGQSGRICW HLASVALVER AAA                                    153
//

If you have problems or comments...

PBIL Back to PBIL home page