(data stored in ACNUC7421 zone)

EMBL: CP002299.PE274

CP002299.PE274       Location/Qualifiers
FT   CDS             348222..348431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0276"
FT                   /product="sigma-70 region 4 domain protein"
FT                   /note="PFAM: sigma-70 region 4 domain protein; KEGG:
FT                   fal:FRAAL5350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78362"
FT                   /db_xref="GOA:E3J671"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="UniProtKB/TrEMBL:E3J671"
FT                   /inference="protein motif:PFAM:PF04545"
FT                   /protein_id="ADP78362.1"
FT                   /translation="MGDVPQLWTTKDIGAHLGISRERARQLSHGDDFPAPVGQVGHIRM
FT                   WSAPDVEAWATEHRPDKADAGDAQ"
     MGDVPQLWTT KDIGAHLGIS RERARQLSHG DDFPAPVGQV GHIRMWSAPD VEAWATEHRP        60
     DKADAGDAQ                                                                69
//

If you have problems or comments...

PBIL Back to PBIL home page