(data stored in ACNUC7421 zone)

EMBL: CP002299.PE279

CP002299.PE279       Location/Qualifiers
FT   CDS             complement(352444..353565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0281"
FT                   /product="ABC transporter related protein"
FT                   /note="KEGG: fal:FRAAL6619 putative ABC transporter
FT                   ATP-binding subunit; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78367"
FT                   /db_xref="GOA:E3J794"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J794"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADP78367.1"
FT                   /translation="MIDARGLTKRYGRTLAVNDLSFTVRSGRVTGFLGPNGAGKSTTMR
FT                   MILGLDRPTAGEVRIGRKRYADLTNPMRHVGALLDAKWVHPNRSARAHLRWLAAANRLP
FT                   DRRVDEVLEIVGLTDVAHRRAGGFSLGMAQRLGIAGALLGDPGVMLFDEPVNGLDPEGI
FT                   LWIRRLMHRLADEGRTVFVSSHLLSEMAVTASELVVIGRGRLIAQTTTAAFTDQASGAT
FT                   VRVRGPEPHRLRAVLTAGGLAVDEVPASDAGPAAFTVHDATTEAVGELAGAAGLVLHEL
FT                   AAQRGSLEEAFLQLTSRDVEYRAGDGYSEPAGFPEPAGYPEPAGYPEPAGYPEPAGYPE
FT                   PAGYPEPAGYPEPAGYAEPAGGLVWEAETSWPA"
     MIDARGLTKR YGRTLAVNDL SFTVRSGRVT GFLGPNGAGK STTMRMILGL DRPTAGEVRI        60
     GRKRYADLTN PMRHVGALLD AKWVHPNRSA RAHLRWLAAA NRLPDRRVDE VLEIVGLTDV       120
     AHRRAGGFSL GMAQRLGIAG ALLGDPGVML FDEPVNGLDP EGILWIRRLM HRLADEGRTV       180
     FVSSHLLSEM AVTASELVVI GRGRLIAQTT TAAFTDQASG ATVRVRGPEP HRLRAVLTAG       240
     GLAVDEVPAS DAGPAAFTVH DATTEAVGEL AGAAGLVLHE LAAQRGSLEE AFLQLTSRDV       300
     EYRAGDGYSE PAGFPEPAGY PEPAGYPEPA GYPEPAGYPE PAGYPEPAGY PEPAGYAEPA       360
     GGLVWEAETS WPA                                                          373
//

If you have problems or comments...

PBIL Back to PBIL home page