(data stored in ACNUC7421 zone)

EMBL: CP002299.PE280

CP002299.PE280       Location/Qualifiers
FT   CDS             354160..354438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0282"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6610 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78368"
FT                   /db_xref="UniProtKB/TrEMBL:E3J795"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6610"
FT                   /protein_id="ADP78368.1"
FT                   /translation="MSVGRPARRAAGVQQTLPVPLRGLGQPGRGRHVPVTASCGGCDQR
FT                   WTDEAATHCRGCHGHWPDLAGFDEHLPACPAYVSFVPPSRSRARKAS"
     MSVGRPARRA AGVQQTLPVP LRGLGQPGRG RHVPVTASCG GCDQRWTDEA ATHCRGCHGH        60
     WPDLAGFDEH LPACPAYVSF VPPSRSRARK AS                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page