(data stored in ACNUC7421 zone)

EMBL: CP002299.PE282

CP002299.PE282       Location/Qualifiers
FT   CDS             356772..357503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0284"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6608 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78370"
FT                   /db_xref="UniProtKB/TrEMBL:E3J797"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6608"
FT                   /protein_id="ADP78370.1"
FT                   /translation="MTLCGLLRLDGADVRRSTLTAMLASSSLGLPAARGVHLDGPFGVV
FT                   TAAGRAGGPIPPIVVDDGGLMAVVLAGRGHLRLAGWPACPAGQAGDAGEPSGSARDEDT
FT                   AALSVAAAYRASGERCLRELPPDRLVLVWDPGARRLLVTRTGRFAADLLTWSDGRHLAF
FT                   GTEPAQLLAAFRAPAQVVGPRLDGSGRPRRLVRRLAVGEGISISVTAARRGPRPSRPAA
FT                   LRLVPRPAAPDSADRHRIDRD"
     MTLCGLLRLD GADVRRSTLT AMLASSSLGL PAARGVHLDG PFGVVTAAGR AGGPIPPIVV        60
     DDGGLMAVVL AGRGHLRLAG WPACPAGQAG DAGEPSGSAR DEDTAALSVA AAYRASGERC       120
     LRELPPDRLV LVWDPGARRL LVTRTGRFAA DLLTWSDGRH LAFGTEPAQL LAAFRAPAQV       180
     VGPRLDGSGR PRRLVRRLAV GEGISISVTA ARRGPRPSRP AALRLVPRPA APDSADRHRI       240
     DRD                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page