(data stored in ACNUC7421 zone)

EMBL: CP002299.PE288

CP002299.PE288       Location/Qualifiers
FT   CDS             362033..363019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0290"
FT                   /product="NAD(P)H quinone oxidoreductase, PIG3 family"
FT                   /note="KEGG: fal:FRAAL6600 putative quinone oxidoreductase;
FT                   TIGRFAM: NAD(P)H quinone oxidoreductase, PIG3 family; PFAM:
FT                   Alcohol dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78376"
FT                   /db_xref="GOA:E3J7A3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7A3"
FT                   /inference="protein motif:TFAM:TIGR02824"
FT                   /protein_id="ADP78376.1"
FT                   /translation="MYAVTVDEPGGPEVLEWREVDDPPGPGPDEVVIDVVATAVNRADL
FT                   LQRQGLYAPPPGASDIIGLECSGRIAAVGPGVDGWRVGDEVCALLSGGGYATKVVVPAG
FT                   QVLPVPPGVDLVTAGGLPEVTSTVYSTVFQRAQLLDGETFLVHGGASGIGTFAIQAVRA
FT                   LRPKALIATTAGSPEKLERCRELGADVTICYRDEDFVARVKEATGGRGADVILDNMGAK
FT                   YLARNVDVLAPDGRLVVIGMQGGIKAELNLATLLTKRGAVHAMSLRHRPGEQKAAIVAG
FT                   VRAEVWPAFASGAIRPVIDRVLPLREAAEAHRVVESLGHVGKVLLAV"
     MYAVTVDEPG GPEVLEWREV DDPPGPGPDE VVIDVVATAV NRADLLQRQG LYAPPPGASD        60
     IIGLECSGRI AAVGPGVDGW RVGDEVCALL SGGGYATKVV VPAGQVLPVP PGVDLVTAGG       120
     LPEVTSTVYS TVFQRAQLLD GETFLVHGGA SGIGTFAIQA VRALRPKALI ATTAGSPEKL       180
     ERCRELGADV TICYRDEDFV ARVKEATGGR GADVILDNMG AKYLARNVDV LAPDGRLVVI       240
     GMQGGIKAEL NLATLLTKRG AVHAMSLRHR PGEQKAAIVA GVRAEVWPAF ASGAIRPVID       300
     RVLPLREAAE AHRVVESLGH VGKVLLAV                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page