(data stored in ACNUC7421 zone)

EMBL: CP002299.PE289

CP002299.PE289       Location/Qualifiers
FT   CDS             363075..363647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0291"
FT                   /product="Protein of unknown function DUF2587"
FT                   /note="PFAM: Protein of unknown function DUF2587; KEGG:
FT                   fal:FRAAL6599 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78377"
FT                   /db_xref="GOA:E3J7A4"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7A4"
FT                   /inference="protein motif:PFAM:PF10759"
FT                   /protein_id="ADP78377.1"
FT                   /translation="MRLDGDMTDQPEPRVVVVGPDGRLRSPLDGAGAGSDHAGDGGSDS
FT                   PDPRTMISSMVSQPDKVMRIGTMIKQLLEEVRAAPLDEASRLRLREIHRSSIRELSDGL
FT                   APELKDELDRLSLPFDDSQTPSDAEIRIAQAQLVGWLEGLFHGLQTALFAQQMAARAQL
FT                   EEMRRRALPSGQPGQSGQDGFGTGTYL"
     MRLDGDMTDQ PEPRVVVVGP DGRLRSPLDG AGAGSDHAGD GGSDSPDPRT MISSMVSQPD        60
     KVMRIGTMIK QLLEEVRAAP LDEASRLRLR EIHRSSIREL SDGLAPELKD ELDRLSLPFD       120
     DSQTPSDAEI RIAQAQLVGW LEGLFHGLQT ALFAQQMAAR AQLEEMRRRA LPSGQPGQSG       180
     QDGFGTGTYL                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page