(data stored in ACNUC7421 zone)

EMBL: CP002299.PE290

CP002299.PE290       Location/Qualifiers
FT   CDS             complement(363661..365064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6598 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78378"
FT                   /db_xref="GOA:E3J7A5"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7A5"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6598"
FT                   /protein_id="ADP78378.1"
FT                   /translation="MTEASHEIVERALAASRADGCIVIATESSTVNLRWANNTLTTNGA
FT                   ARDRSVTVVSIVGRSFGVRSVSTIEAGTTGVDKLTELVRSAEAAAKDADDAEDYADLLA
FT                   PGQPGAATSPEPFDALAERTSTSVFTRFAADLGEALRAARAEGRGLYGFAEHDLTTTWL
FT                   GTSTGLRLRHSQPTGSVEWNAKNGQPGGSVWHGQATHDFSDVDVAATDAELRRRLGWCA
FT                   RTIDLPAGRYETLLPPSAVSDLILDAYWSAAGRDAAEGRTVFSKAGGGTRLGEAFGPAG
FT                   MTLYSDPADPELSCAPFAVSGHSSATASVFDNGLALGRTNWLDDGKLAALVHTRSSAQA
FT                   AGARPTPFVDNLTMDAGGTATLDDMVASTKRGLLLTCLWYIREVDPEVLLLTGLTRDGV
FT                   YLVENGEVTGAVNNFRFNESPVSLLGRITELGAASRTLGREWADWFKLSRMPAVRVPDF
FT                   NMSSVSPAS"
     MTEASHEIVE RALAASRADG CIVIATESST VNLRWANNTL TTNGAARDRS VTVVSIVGRS        60
     FGVRSVSTIE AGTTGVDKLT ELVRSAEAAA KDADDAEDYA DLLAPGQPGA ATSPEPFDAL       120
     AERTSTSVFT RFAADLGEAL RAARAEGRGL YGFAEHDLTT TWLGTSTGLR LRHSQPTGSV       180
     EWNAKNGQPG GSVWHGQATH DFSDVDVAAT DAELRRRLGW CARTIDLPAG RYETLLPPSA       240
     VSDLILDAYW SAAGRDAAEG RTVFSKAGGG TRLGEAFGPA GMTLYSDPAD PELSCAPFAV       300
     SGHSSATASV FDNGLALGRT NWLDDGKLAA LVHTRSSAQA AGARPTPFVD NLTMDAGGTA       360
     TLDDMVASTK RGLLLTCLWY IREVDPEVLL LTGLTRDGVY LVENGEVTGA VNNFRFNESP       420
     VSLLGRITEL GAASRTLGRE WADWFKLSRM PAVRVPDFNM SSVSPAS                     467
//

If you have problems or comments...

PBIL Back to PBIL home page