(data stored in ACNUC7421 zone)

EMBL: CP002299.PE299

CP002299.PE299       Location/Qualifiers
FT   CDS             372486..373400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0301"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="KEGG: fal:FRAAL6593 hypothetical protein; PFAM:
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78387"
FT                   /db_xref="GOA:E3J7B4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7B4"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ADP78387.1"
FT                   /translation="MADDIVDVVPSLGVPALGAEPGSSTLAGELGRALAGLRKRKGMTG
FT                   EELGRAIGASQAKISKIERGALRPSPLDVEKIVLALDGSKDALHELVGQATELQALSSR
FT                   PRLPRRGPVNQQDYADLESRATLVRDFEPITVPGLMQISEYTRRVINAFHAVDIGDHES
FT                   KWAETAAKVTQRLQRQERLYDTNKTFEFILLENLLNNMYVTPGYMLAQVDRIEQIAKLP
FT                   NVTVRIVPMTAQLGLPPSHGFMIFDDDVVVTESLDATVYQDRRSVEFYTHFFESYRELA
FT                   NADLFEVLERYKARYADMAMPKP"
     MADDIVDVVP SLGVPALGAE PGSSTLAGEL GRALAGLRKR KGMTGEELGR AIGASQAKIS        60
     KIERGALRPS PLDVEKIVLA LDGSKDALHE LVGQATELQA LSSRPRLPRR GPVNQQDYAD       120
     LESRATLVRD FEPITVPGLM QISEYTRRVI NAFHAVDIGD HESKWAETAA KVTQRLQRQE       180
     RLYDTNKTFE FILLENLLNN MYVTPGYMLA QVDRIEQIAK LPNVTVRIVP MTAQLGLPPS       240
     HGFMIFDDDV VVTESLDATV YQDRRSVEFY THFFESYREL ANADLFEVLE RYKARYADMA       300
     MPKP                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page