(data stored in ACNUC7421 zone)

EMBL: CP002299.PE300

CP002299.PE300       Location/Qualifiers
FT   CDS             complement(373622..374410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0302"
FT                   /product="Cof-like hydrolase"
FT                   /note="KEGG: fal:FRAAL6592 hypothetical protein; TIGRFAM:
FT                   Cof-like hydrolase; HAD-superfamily hydrolase, subfamily
FT                   IIB; PFAM: Haloacid dehalogenase domain protein hydrolase
FT                   type 3"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78388"
FT                   /db_xref="GOA:E3J7B5"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7B5"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ADP78388.1"
FT                   /translation="MSPPAIVATDLDGTLIRSDGTVSERTRRALRRVREHGATVVFVTG
FT                   RPIRVMADVVAKTSVAGIAVCANGALVYDLDAQTTVNHRELDQRAALRLAQAIREMVPD
FT                   VAFAVESGLRFGREPGFRTMWPDPLELVADLADLLVTLPPIKLLVRRSGESLADVYEKV
FT                   VDLAGAEAVVTRSTETLIEIAGAGVSKAVALAEVATARGVTAADVVAFGDMLNDLPMLA
FT                   WAGHAVAVANAHPQVLAAADEITASNDQDGVALVLERLFD"
     MSPPAIVATD LDGTLIRSDG TVSERTRRAL RRVREHGATV VFVTGRPIRV MADVVAKTSV        60
     AGIAVCANGA LVYDLDAQTT VNHRELDQRA ALRLAQAIRE MVPDVAFAVE SGLRFGREPG       120
     FRTMWPDPLE LVADLADLLV TLPPIKLLVR RSGESLADVY EKVVDLAGAE AVVTRSTETL       180
     IEIAGAGVSK AVALAEVATA RGVTAADVVA FGDMLNDLPM LAWAGHAVAV ANAHPQVLAA       240
     ADEITASNDQ DGVALVLERL FD                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page