(data stored in ACNUC7421 zone)

EMBL: CP002299.PE302

CP002299.PE302       Location/Qualifiers
FT   CDS             375021..375866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0304"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="TIGRFAM: ATP phosphoribosyltransferase; KEGG:
FT                   fal:FRAAL6590 ATP phosphoribosyltransferase; PFAM: ATP
FT                   phosphoribosyltransferase catalytic region; Histidine
FT                   biosynthesis protein HisG domain"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78390"
FT                   /db_xref="GOA:E3J7B7"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7B7"
FT                   /inference="protein motif:TFAM:TIGR03455"
FT                   /protein_id="ADP78390.1"
FT                   /translation="MLRIAVPNKGALSAASSQLLGDAGYHVKRDGAELVVADVENDIEF
FT                   FFLRPRDIAVYVGAGRLDVGITGRDLLLDSGVPARELVALGFGHSTFRYAAPKGAIADV
FT                   AELDGLRIATSFPGLVRADFAARGLTAQVVTLDGAVETAVRLGVADAVADVVETGRTLR
FT                   AAGLELVGEPVMRSEAIMITKQGAELGSAQERLLRRVQGVLVARRYVIMDYDAPTDVLE
FT                   KACEITPGFESPTISPLAREGWVAVRAMVLKDDVNRTMDDLWDLGARGILVSAIQACRL
FT                   "
     MLRIAVPNKG ALSAASSQLL GDAGYHVKRD GAELVVADVE NDIEFFFLRP RDIAVYVGAG        60
     RLDVGITGRD LLLDSGVPAR ELVALGFGHS TFRYAAPKGA IADVAELDGL RIATSFPGLV       120
     RADFAARGLT AQVVTLDGAV ETAVRLGVAD AVADVVETGR TLRAAGLELV GEPVMRSEAI       180
     MITKQGAELG SAQERLLRRV QGVLVARRYV IMDYDAPTDV LEKACEITPG FESPTISPLA       240
     REGWVAVRAM VLKDDVNRTM DDLWDLGARG ILVSAIQACR L                           281
//

If you have problems or comments...

PBIL Back to PBIL home page