(data stored in ACNUC7421 zone)

EMBL: CP002299.PE304

CP002299.PE304       Location/Qualifiers
FT   CDS             complement(376769..378925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0306"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="SMART: AAA ATPase; TIGRFAM: ATP-dependent
FT                   metalloprotease FtsH; KEGG: fal:FRAAL6588 cell division
FT                   protein FtsH (ATP-dependent zinc-metallo protease); PFAM:
FT                   peptidase M41; AAA ATPase central domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78392"
FT                   /db_xref="GOA:E3J7B9"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7B9"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ADP78392.1"
FT                   /translation="MTPRRIFRGWVVLALLVLLVIFLTTNVLSGPKEYSKENLHDIQAK
FT                   IAAGQVKSATIEDSKQIVQITTKDDKKYESSYVTNQAVSLAAELNDKNVPYEVKVERSN
FT                   VLVSLLLNLLPLVLVVALFLFLMNQMQGGGNRVMNFGKSKAKLVNKDTPKTTFADVAGA
FT                   DEALEELQEIKEFLENPGKFQAIGAKIPKGVLLYGPPGTGKTLLARAVAGEAGVPFYSI
FT                   SGSDFVEMFVGVGASRVRDLFEQAKANAPAIIFVDEIDAVGRHRGAGLGGGHDEREQTL
FT                   NQLLVEMDGFDVKGGVILIAATNRPDILDPALLRPGRFDRQIVVDRPDLLGREAILKVH
FT                   AKGKPIGPDVDLLVIARRTPGFTGADLANVLNEAALLAARADQKMISSDLLEESIDRVL
FT                   AGPERKTRAMSDKEKKRIAYHEGGHALVAHALPNSDPVHKITILPRGRALGYTMQLPLE
FT                   DKYLSTRSEMLDKLAVLLGGRTAEEVVFHEPTTGASDDIEKATQIARAMVTQYGMSDKL
FT                   GALKFGAESGEVFLGREVGHQRDYSEAVAGEIDNEVRKLIEAAHDEAWEVLNTYRDELD
FT                   NLVLRLMDTETLSKDDVLETFATVQKRPVRGFYTGVGRRVPSDRPPVQTPAELGLVASD
FT                   VADLVKGNGNGNGHPTGNGSPGLNNPAAAPGQGADTGHGPVSGPVNGPTGPAGPPAAPP
FT                   PDAPRISNPWAPPVWPNDDERKRS"
     MTPRRIFRGW VVLALLVLLV IFLTTNVLSG PKEYSKENLH DIQAKIAAGQ VKSATIEDSK        60
     QIVQITTKDD KKYESSYVTN QAVSLAAELN DKNVPYEVKV ERSNVLVSLL LNLLPLVLVV       120
     ALFLFLMNQM QGGGNRVMNF GKSKAKLVNK DTPKTTFADV AGADEALEEL QEIKEFLENP       180
     GKFQAIGAKI PKGVLLYGPP GTGKTLLARA VAGEAGVPFY SISGSDFVEM FVGVGASRVR       240
     DLFEQAKANA PAIIFVDEID AVGRHRGAGL GGGHDEREQT LNQLLVEMDG FDVKGGVILI       300
     AATNRPDILD PALLRPGRFD RQIVVDRPDL LGREAILKVH AKGKPIGPDV DLLVIARRTP       360
     GFTGADLANV LNEAALLAAR ADQKMISSDL LEESIDRVLA GPERKTRAMS DKEKKRIAYH       420
     EGGHALVAHA LPNSDPVHKI TILPRGRALG YTMQLPLEDK YLSTRSEMLD KLAVLLGGRT       480
     AEEVVFHEPT TGASDDIEKA TQIARAMVTQ YGMSDKLGAL KFGAESGEVF LGREVGHQRD       540
     YSEAVAGEID NEVRKLIEAA HDEAWEVLNT YRDELDNLVL RLMDTETLSK DDVLETFATV       600
     QKRPVRGFYT GVGRRVPSDR PPVQTPAELG LVASDVADLV KGNGNGNGHP TGNGSPGLNN       660
     PAAAPGQGAD TGHGPVSGPV NGPTGPAGPP AAPPPDAPRI SNPWAPPVWP NDDERKRS         718
//

If you have problems or comments...

PBIL Back to PBIL home page