(data stored in ACNUC7421 zone)

EMBL: CP002299.PE309

CP002299.PE309       Location/Qualifiers
FT   CDS             385076..385408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0311"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bid:Bind_2584 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78397"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7C4"
FT                   /inference="similar to AA sequence:KEGG:Bind_2584"
FT                   /protein_id="ADP78397.1"
FT                   /translation="MAVVAWRGLRGAGRLARPPSEATYDPVVSSRLDRSWLVLASHQTA
FT                   EADRCVDIFRRPEGTFGFEEFRKDPEDMGRWTPVSYFSGWQYPTEDETLDAACATVPWL
FT                   GPLVGR"
     MAVVAWRGLR GAGRLARPPS EATYDPVVSS RLDRSWLVLA SHQTAEADRC VDIFRRPEGT        60
     FGFEEFRKDP EDMGRWTPVS YFSGWQYPTE DETLDAACAT VPWLGPLVGR                  110
//

If you have problems or comments...

PBIL Back to PBIL home page