(data stored in ACNUC7421 zone)

EMBL: CP002299.PE31

CP002299.PE31        Location/Qualifiers
FT   CDS             complement(36443..37285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0031"
FT                   /product="mycothiol-dependent maleylpyruvate isomerase"
FT                   /note="KEGG: fal:FRAAL6831 mycothiol-dependent
FT                   maleylpyruvate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78119"
FT                   /db_xref="GOA:E3J281"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:E3J281"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6831"
FT                   /protein_id="ADP78119.1"
FT                   /translation="MATETRAGVRESGLPPSARATHTTPAGAGYLPSPVPHDLLAGVSA
FT                   SHRRLLALAAALDDATVARPSLLPGWTVGHLLRHLTVGARGHTSLVQAACAGAAPIALN
FT                   SSDPAADDPTAHPGTDSAERLRDDLAAAIAGLERAWDATHVEVWRTGLGMCRLEPAAGS
FT                   RLDGPVTLADLVFLRWREVEIHGVDLGLADRGGPGWADLPAPYVDAEWDWTTARLPERL
FT                   PPGVSVVLAPGDRSSRAFGAGPRPAVVRTSTAETLRWLLGRLPRPAAPSGWPDLCSWE"
     MATETRAGVR ESGLPPSARA THTTPAGAGY LPSPVPHDLL AGVSASHRRL LALAAALDDA        60
     TVARPSLLPG WTVGHLLRHL TVGARGHTSL VQAACAGAAP IALNSSDPAA DDPTAHPGTD       120
     SAERLRDDLA AAIAGLERAW DATHVEVWRT GLGMCRLEPA AGSRLDGPVT LADLVFLRWR       180
     EVEIHGVDLG LADRGGPGWA DLPAPYVDAE WDWTTARLPE RLPPGVSVVL APGDRSSRAF       240
     GAGPRPAVVR TSTAETLRWL LGRLPRPAAP SGWPDLCSWE                             280
//

If you have problems or comments...

PBIL Back to PBIL home page