(data stored in ACNUC7421 zone)

EMBL: CP002299.PE310

CP002299.PE310       Location/Qualifiers
FT   CDS             386211..386936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0312"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: fal:FRAAL6583 two-component system response
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain-containing protein; SMART:
FT                   response regulator receiver; transcriptional regulator
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78398"
FT                   /db_xref="GOA:E3J7C5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7C5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADP78398.1"
FT                   /translation="MTGEAVATTTRGASLLVAEDDEASRVALARSLERFGYRVLEAADG
FT                   ETALRLFQTTEIDLVVLDVAMPRMDGFAVLSRLRQTSEVPVIMLTGRAEEVDRVVGLEL
FT                   GADDYVVKPYSLRELVARVRARLRRRPVEAPPQRSGDGNEPLIYGDVSIDLRAREVAVA
FT                   GERIDLTAREYELLAFLARHPRRVFSREELLEQVWGTRFQDPATVTEHVRRVRTKVEGR
FT                   PPQRRLVTTLRGMGYRFDP"
     MTGEAVATTT RGASLLVAED DEASRVALAR SLERFGYRVL EAADGETALR LFQTTEIDLV        60
     VLDVAMPRMD GFAVLSRLRQ TSEVPVIMLT GRAEEVDRVV GLELGADDYV VKPYSLRELV       120
     ARVRARLRRR PVEAPPQRSG DGNEPLIYGD VSIDLRAREV AVAGERIDLT AREYELLAFL       180
     ARHPRRVFSR EELLEQVWGT RFQDPATVTE HVRRVRTKVE GRPPQRRLVT TLRGMGYRFD       240
     P                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page