(data stored in ACNUC7421 zone)

EMBL: CP002299.PE312

CP002299.PE312       Location/Qualifiers
FT   CDS             388669..388854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0314"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL4321 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78400"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7C7"
FT                   /inference="similar to AA sequence:KEGG:FRAAL4321"
FT                   /protein_id="ADP78400.1"
FT                   /translation="MKATYQAPTLQDAGSFRDLTGYGFVGVGGFGGWGGGGWGGWGGGW
FT                   GGWGGGGGWGGWGGGW"
     MKATYQAPTL QDAGSFRDLT GYGFVGVGGF GGWGGGGWGG WGGGWGGWGG GGGWGGWGGG        60
     W                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page