(data stored in ACNUC7421 zone)

EMBL: CP002299.PE313

CP002299.PE313       Location/Qualifiers
FT   CDS             389088..390359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0315"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: fal:FRAAL4320
FT                   putative hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78401"
FT                   /db_xref="GOA:E3J7C8"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7C8"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ADP78401.1"
FT                   /translation="MRIVCVGGGPAGLYFAICAKRRNPDHEITVLERDPAGATHGWGVA
FT                   YWEPLIDNMFHNDPVCALAVQDAAALWQEHRLAVGTRTAYLPGHGYGIQRSVLLDVFAR
FT                   RATELGVRLHYRQGIVDEAELRALCAENDLVVAADGGRSQVRRLAGTDVFGTRLEEGLN
FT                   PYIWLGTDQRFTDFRFAFQRTPHGWIWFHAYPSASDVGTCVFECAPTTWTGLGLDRLDD
FT                   AAGRELLETIFADQLAGHRLLGGGEGDRGTSRPAHWQRFTHVSNRSWRHDNIVLIGDAA
FT                   HTTHFTFGSGTALAMMDAVMLARFLRRHDGDLPAALTAFDTAGRKALGRVQAHARRGSD
FT                   WFERIDDLFDNELASPQDSIDGPDPVTVAAALSSRHGGGIQPLRRRVLRSNQVPAVRRV
FT                   RREASTGGRWLRERRRARELTRAG"
     MRIVCVGGGP AGLYFAICAK RRNPDHEITV LERDPAGATH GWGVAYWEPL IDNMFHNDPV        60
     CALAVQDAAA LWQEHRLAVG TRTAYLPGHG YGIQRSVLLD VFARRATELG VRLHYRQGIV       120
     DEAELRALCA ENDLVVAADG GRSQVRRLAG TDVFGTRLEE GLNPYIWLGT DQRFTDFRFA       180
     FQRTPHGWIW FHAYPSASDV GTCVFECAPT TWTGLGLDRL DDAAGRELLE TIFADQLAGH       240
     RLLGGGEGDR GTSRPAHWQR FTHVSNRSWR HDNIVLIGDA AHTTHFTFGS GTALAMMDAV       300
     MLARFLRRHD GDLPAALTAF DTAGRKALGR VQAHARRGSD WFERIDDLFD NELASPQDSI       360
     DGPDPVTVAA ALSSRHGGGI QPLRRRVLRS NQVPAVRRVR REASTGGRWL RERRRARELT       420
     RAG                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page