(data stored in ACNUC7421 zone)

EMBL: CP002299.PE314

CP002299.PE314       Location/Qualifiers
FT   CDS             complement(390356..391612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0316"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="KEGG: fal:FRAAL6581 DNA polymerase III subunit
FT                   delta'; PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78402"
FT                   /db_xref="GOA:E3J7C9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7C9"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ADP78402.1"
FT                   /translation="MTVWDALVGQDAVVETLEAAAAAATLVGGPQGALAAARAGMTHSW
FT                   LFTGPAGAGRTDAARAFAAALSCVRADGTSARPGCGECVGCHTVLTDTAADLRTVRAEG
FT                   LSLGVQDVRALVRDAASAPTSGRYRILLIEEADRLTDSAANALLKALEEPAQRSVFLLC
FT                   APSVDDVMPTIRSRCRVVALRLPTVDDLVGALRRDGVDEATAQVAARAAQGHLGRARLL
FT                   ATDDETRGRRAQVLALPSRLGRVAECLAAAGDLVAAANADAQTANSERDEAEAGALRTA
FT                   LGMGATSSGGTGRTKRVTKAAPKAKTMMVRGAAGALKDLEKSQKSRGRRTVLDSLDRAL
FT                   LDLAGLYRDVLARQLGATVDPVNPDATREIASLAARATPERTLQRLEAVLATRDALAAN
FT                   PGLVAQLTVESLALTLREP"
     MTVWDALVGQ DAVVETLEAA AAAATLVGGP QGALAAARAG MTHSWLFTGP AGAGRTDAAR        60
     AFAAALSCVR ADGTSARPGC GECVGCHTVL TDTAADLRTV RAEGLSLGVQ DVRALVRDAA       120
     SAPTSGRYRI LLIEEADRLT DSAANALLKA LEEPAQRSVF LLCAPSVDDV MPTIRSRCRV       180
     VALRLPTVDD LVGALRRDGV DEATAQVAAR AAQGHLGRAR LLATDDETRG RRAQVLALPS       240
     RLGRVAECLA AAGDLVAAAN ADAQTANSER DEAEAGALRT ALGMGATSSG GTGRTKRVTK       300
     AAPKAKTMMV RGAAGALKDL EKSQKSRGRR TVLDSLDRAL LDLAGLYRDV LARQLGATVD       360
     PVNPDATREI ASLAARATPE RTLQRLEAVL ATRDALAANP GLVAQLTVES LALTLREP         418
//

If you have problems or comments...

PBIL Back to PBIL home page