(data stored in ACNUC7421 zone)

EMBL: CP002299.PE315

CP002299.PE315       Location/Qualifiers
FT   CDS             complement(391609..394071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0317"
FT                   /product="protein of unknown function DUF894 DitE"
FT                   /note="PFAM: protein of unknown function DUF894 DitE;
FT                   thymidylate kinase; KEGG: fal:FRAAL6580 thymidylate kinase
FT                   (dTMP kinase) (partial match)"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78403"
FT                   /db_xref="GOA:E3J7D0"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7D0"
FT                   /inference="protein motif:PFAM:PF05977"
FT                   /protein_id="ADP78403.1"
FT                   /translation="MSTADEAEGSVRRAQLGFQDARDDQPGTGSPGPQAAAPSRAAHGP
FT                   DGPSGATAPNGRAELPADGPEGADTALVVRRARRAGWAHRSVGQHPVTSVPEPPERRAP
FT                   ASSDEGDVRAVLRIPEFRRLWIQLGLSSLGDWMGLLATTAMVAELAHSFSGQAYGIGSL
FT                   LIIRLMPALIFGPIAGAVADKLDRRRTMVVTDLMRFALFASIPIVGTLAWLFIASFLVE
FT                   CVTLLWAPAKEASVPHLVPKERLAAANTLSLITTYGSAPVAAAIFALLATLARSLAPSY
FT                   PWFRDSPVDLALYFNAVTFLLSAIVIWGLRSIGKAQRPDQGPEPGFFASITEGWKFVGQ
FT                   DRLVRGLVVGILGGFAGAGCVIALGRLYVHILGGGDSAYGVLFGAVFVGLAAGMAAGPR
FT                   LLGDYSRTRLFGVCVTGAGITLVFVAIIPNLVLACILVVLVGMFAGVAWVTGNTLLQAE
FT                   VADELRGRTFALVQSLVRVDLLLVLAVAPALVGLIGTHQIHLWGEVNVRADGVTVVLLA
FT                   GGALAIVVGLFAYRQMDDHSGVPVLPELWNALRGRRGVRRPRHAGLFVAIEGADFRSRA
FT                   DQLESLRRWLLEAGREVLVTAESPADTSELEAALRTVQPDPAAGLHPRTTALLTAAIHA
FT                   EHVARVIEPALARGAVVLTDSYVDAEIARQSAEACAALDELTILSHWATRSLVPDVTIL
FT                   LDVEPRNPSAPGTPANGTSTNGARANGHGGLFDQRVRAALLQLADDEPHRYLVLDGTAP
FT                   ASELRGRIRQAVQRRLTEPATAATATAATDHDPVYDDALYDAAYPGRANGAGRPAGSVD
FT                   GAGPEGSA"
     MSTADEAEGS VRRAQLGFQD ARDDQPGTGS PGPQAAAPSR AAHGPDGPSG ATAPNGRAEL        60
     PADGPEGADT ALVVRRARRA GWAHRSVGQH PVTSVPEPPE RRAPASSDEG DVRAVLRIPE       120
     FRRLWIQLGL SSLGDWMGLL ATTAMVAELA HSFSGQAYGI GSLLIIRLMP ALIFGPIAGA       180
     VADKLDRRRT MVVTDLMRFA LFASIPIVGT LAWLFIASFL VECVTLLWAP AKEASVPHLV       240
     PKERLAAANT LSLITTYGSA PVAAAIFALL ATLARSLAPS YPWFRDSPVD LALYFNAVTF       300
     LLSAIVIWGL RSIGKAQRPD QGPEPGFFAS ITEGWKFVGQ DRLVRGLVVG ILGGFAGAGC       360
     VIALGRLYVH ILGGGDSAYG VLFGAVFVGL AAGMAAGPRL LGDYSRTRLF GVCVTGAGIT       420
     LVFVAIIPNL VLACILVVLV GMFAGVAWVT GNTLLQAEVA DELRGRTFAL VQSLVRVDLL       480
     LVLAVAPALV GLIGTHQIHL WGEVNVRADG VTVVLLAGGA LAIVVGLFAY RQMDDHSGVP       540
     VLPELWNALR GRRGVRRPRH AGLFVAIEGA DFRSRADQLE SLRRWLLEAG REVLVTAESP       600
     ADTSELEAAL RTVQPDPAAG LHPRTTALLT AAIHAEHVAR VIEPALARGA VVLTDSYVDA       660
     EIARQSAEAC AALDELTILS HWATRSLVPD VTILLDVEPR NPSAPGTPAN GTSTNGARAN       720
     GHGGLFDQRV RAALLQLADD EPHRYLVLDG TAPASELRGR IRQAVQRRLT EPATAATATA       780
     ATDHDPVYDD ALYDAAYPGR ANGAGRPAGS VDGAGPEGSA                             820
//

If you have problems or comments...

PBIL Back to PBIL home page