(data stored in ACNUC7421 zone)

EMBL: CP002299.PE32

CP002299.PE32        Location/Qualifiers
FT   CDS             38326..39561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0032"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="TIGRFAM: spermidine/putrescine ABC transporter
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Transport-associated OB domain-containing protein; KEGG:
FT                   fal:FRAAL6832 polyamine ABC-transporter ATP-binding
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78120"
FT                   /db_xref="GOA:E3J282"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J282"
FT                   /inference="protein motif:TFAM:TIGR01187"
FT                   /protein_id="ADP78120.1"
FT                   /translation="MRVLAVTADGVSTSVPAVSTPTVPTGGTGAAAPAIELIGVAKDYA
FT                   SRRGAVTAVETVDLQIAEGEFFSLLGPSGCGKTTTLRMIGGFEEPSRGQILLHGSDVTA
FT                   TPPNRRDVNLVFQSYALFPHLDVAGNVAFGLKRKGIRGQAMRDRVTNMLELVELGALAD
FT                   RKPKELSGGQQQRVALARALVNEPRALLLDEPLGALDLKLRETMQIELKRIQREVGITF
FT                   VYVTHDQSEALTMSDRIAVMNKGRIEQLAAPRDLYERPRTRFVAGFIGTSNVLRRTVKT
FT                   VTTDGTGPVAILDAGIDEQLMVPLHDDLGSVTTGSVVELTVRPEKIGMTVERPDGDVCL
FT                   LRGRVTEVVYLGTNTTYTVFTPGGDEITVFWQNSSDSADIARRGDEVWLSWREDHSFAL
FT                   APGAGSSTPAAA"
     MRVLAVTADG VSTSVPAVST PTVPTGGTGA AAPAIELIGV AKDYASRRGA VTAVETVDLQ        60
     IAEGEFFSLL GPSGCGKTTT LRMIGGFEEP SRGQILLHGS DVTATPPNRR DVNLVFQSYA       120
     LFPHLDVAGN VAFGLKRKGI RGQAMRDRVT NMLELVELGA LADRKPKELS GGQQQRVALA       180
     RALVNEPRAL LLDEPLGALD LKLRETMQIE LKRIQREVGI TFVYVTHDQS EALTMSDRIA       240
     VMNKGRIEQL AAPRDLYERP RTRFVAGFIG TSNVLRRTVK TVTTDGTGPV AILDAGIDEQ       300
     LMVPLHDDLG SVTTGSVVEL TVRPEKIGMT VERPDGDVCL LRGRVTEVVY LGTNTTYTVF       360
     TPGGDEITVF WQNSSDSADI ARRGDEVWLS WREDHSFALA PGAGSSTPAA A                411
//

If you have problems or comments...

PBIL Back to PBIL home page