(data stored in ACNUC7421 zone)

EMBL: CP002299.PE320

CP002299.PE320       Location/Qualifiers
FT   CDS             402517..405093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0322"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="KEGG: fal:FRAAL6573 putative ATP-dependent RNA
FT                   helicase; PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; Protein of unknown function
FT                   DUF1998; SMART: DEAD-like helicase; helicase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78408"
FT                   /db_xref="GOA:E3J7D5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7D5"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADP78408.1"
FT                   /translation="MPPCPDRGRTILTRVIPTVGTDRGSEILSRLRADRRRDRCVTHVE
FT                   RVPARLGSPVDWPDWVDPLLLGRLRAAGVTAPWSHQAAAATTAHAGRSVVLATGTASGK
FT                   SLGYLLPVLSALLADPGARALYLAPTKALAHDQLRAIRALTLTAVRAASYDGDTPAAER
FT                   EWVRAHANFVLTNPDMLHRGILPGHRRFGPFLRGLRFVVVDECHGYRGVFGAHVAQVLR
FT                   RLRRVCARYGADPVFVLASATVADPGVAAGRLTGVDVDVVDEDGSPRGATDFVLYEPPL
FT                   FLTAPRDQPGTAAAGISRQRTPQGGGGPGDGAGLETRGGLGAAGGPSAEQGPNAGQGPS
FT                   AGAGPGSVAGPGGSQGVGAGENGAPVRRSATAEAADLMADLVVDGVRTLVFVRSRRAAE
FT                   VVANSARRALGLVAPELGEQIAAYRAGYLAEERRELEARLRSGDLLGVAATSALELGVD
FT                   ISGLDATVIAGYPGTLASLWQQAGRAGRAGQGALAVLVARDDPLDTYLVHHPEAVFGRP
FT                   VEATVFDPDNPYVLGPQLECAAAELPVTEADLALFGPSARAVLDDLVRRGRLRRRPNGW
FT                   YWTQRSRPDVDIRGVGGTPVRIVEADTGRLLGTVDAATSHSTVHAGAVYLHQGVSFVVD
FT                   ELDLDESVAFVVRAAPDWTTTARDHTDIRIVESSRSRPVDDDLTVFFGTVEVTSQVVGY
FT                   QRRLITTGEVLGDVPLDLPPRHLRTRGVWYTVSDRLLEQAAIEPADVPGAVHAAEHAAI
FT                   GLLPLFATCDRWDIGGVSTALHPDTGQTTIFVYDGHPGGAGFAERGYGRFEPWLTATRD
FT                   AVVACECPAGCPSCVQSPKCGNGNDPLDKAAAVRLLDSVLERIRSA"
     MPPCPDRGRT ILTRVIPTVG TDRGSEILSR LRADRRRDRC VTHVERVPAR LGSPVDWPDW        60
     VDPLLLGRLR AAGVTAPWSH QAAAATTAHA GRSVVLATGT ASGKSLGYLL PVLSALLADP       120
     GARALYLAPT KALAHDQLRA IRALTLTAVR AASYDGDTPA AEREWVRAHA NFVLTNPDML       180
     HRGILPGHRR FGPFLRGLRF VVVDECHGYR GVFGAHVAQV LRRLRRVCAR YGADPVFVLA       240
     SATVADPGVA AGRLTGVDVD VVDEDGSPRG ATDFVLYEPP LFLTAPRDQP GTAAAGISRQ       300
     RTPQGGGGPG DGAGLETRGG LGAAGGPSAE QGPNAGQGPS AGAGPGSVAG PGGSQGVGAG       360
     ENGAPVRRSA TAEAADLMAD LVVDGVRTLV FVRSRRAAEV VANSARRALG LVAPELGEQI       420
     AAYRAGYLAE ERRELEARLR SGDLLGVAAT SALELGVDIS GLDATVIAGY PGTLASLWQQ       480
     AGRAGRAGQG ALAVLVARDD PLDTYLVHHP EAVFGRPVEA TVFDPDNPYV LGPQLECAAA       540
     ELPVTEADLA LFGPSARAVL DDLVRRGRLR RRPNGWYWTQ RSRPDVDIRG VGGTPVRIVE       600
     ADTGRLLGTV DAATSHSTVH AGAVYLHQGV SFVVDELDLD ESVAFVVRAA PDWTTTARDH       660
     TDIRIVESSR SRPVDDDLTV FFGTVEVTSQ VVGYQRRLIT TGEVLGDVPL DLPPRHLRTR       720
     GVWYTVSDRL LEQAAIEPAD VPGAVHAAEH AAIGLLPLFA TCDRWDIGGV STALHPDTGQ       780
     TTIFVYDGHP GGAGFAERGY GRFEPWLTAT RDAVVACECP AGCPSCVQSP KCGNGNDPLD       840
     KAAAVRLLDS VLERIRSA                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page