(data stored in ACNUC7421 zone)

EMBL: CP002299.PE321

CP002299.PE321       Location/Qualifiers
FT   CDS             405342..406163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0323"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6572 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78409"
FT                   /db_xref="GOA:E3J7D6"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7D6"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6572"
FT                   /protein_id="ADP78409.1"
FT                   /translation="MFTLGVVLLVIAGGLTADIVLESNDVTQVALFGHEFAFDNWRLFA
FT                   FGLLTGVLTVIALQLMWGGLVRGGRRRRTLRVQRRELAAAGLATGSTVPQATTPAPQAT
FT                   VPQATVPRATVPSATVPQAAAPQPATAPRPRVPQAAVPQPTGPTPQATAPVRSRFGRRS
FT                   TDGTLIGSGRETPAGAATVASAEGARTGPAPVVTADDSATATMPFRRFRRPVGKPADSD
FT                   GAAADRGDAVPAQSTSRTGAGAVYPSDRPKDRVVARARGARDTVGQDTARD"
     MFTLGVVLLV IAGGLTADIV LESNDVTQVA LFGHEFAFDN WRLFAFGLLT GVLTVIALQL        60
     MWGGLVRGGR RRRTLRVQRR ELAAAGLATG STVPQATTPA PQATVPQATV PRATVPSATV       120
     PQAAAPQPAT APRPRVPQAA VPQPTGPTPQ ATAPVRSRFG RRSTDGTLIG SGRETPAGAA       180
     TVASAEGART GPAPVVTADD SATATMPFRR FRRPVGKPAD SDGAAADRGD AVPAQSTSRT       240
     GAGAVYPSDR PKDRVVARAR GARDTVGQDT ARD                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page