(data stored in ACNUC7421 zone)

EMBL: CP002299.PE323

CP002299.PE323       Location/Qualifiers
FT   CDS             complement(406683..407276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0325"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6569 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78411"
FT                   /db_xref="GOA:E3J7D8"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7D8"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6569"
FT                   /protein_id="ADP78411.1"
FT                   /translation="MYRSRSTFATPAARGLGSSVVTPPDPRRPPAARPGEQAAHERGQS
FT                   DPAAPARHRGNRRPDRGQATAELALGLPTLGAIIIVALWLLAAVGAQARVDEAARIGAR
FT                   AAARGEADGQVAAWVRDAAPAGATVKISRQDDRVAVTVHYRLAAAGPLVTPVALTATAT
FT                   APSEQAITDAASADVATPAEVDATPLPPDGENRR"
     MYRSRSTFAT PAARGLGSSV VTPPDPRRPP AARPGEQAAH ERGQSDPAAP ARHRGNRRPD        60
     RGQATAELAL GLPTLGAIII VALWLLAAVG AQARVDEAAR IGARAAARGE ADGQVAAWVR       120
     DAAPAGATVK ISRQDDRVAV TVHYRLAAAG PLVTPVALTA TATAPSEQAI TDAASADVAT       180
     PAEVDATPLP PDGENRR                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page