(data stored in ACNUC7421 zone)

EMBL: CP002299.PE327

CP002299.PE327       Location/Qualifiers
FT   CDS             complement(410971..411843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0329"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6564 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78415"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7E2"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6564"
FT                   /protein_id="ADP78415.1"
FT                   /translation="MSTAPSTQAGPALDPFARVAALPGVAEAVTTARSAVDTLLRHRVL
FT                   RRQSAEVTAEASLRSARASAALEGHDLGLETLRARLTAGESAAQGGDELAVTLGAVRLY
FT                   AELGSLAGAWERAPRQALARMHTLLGRGIVPDGELGRPRADASAADPLGLGTPPGPAEV
FT                   SARLDGLVGLLVEKTTAPAIVVSAIVHGELLALRPFGSLDGMIGRAAARLVLIGRGLDP
FT                   KAVTATDVGHLEAGVDGDGVADYRTAAAGYVHGGADGLRAWLLHCARATELGARESLAV
FT                   CEAISRAAS"
     MSTAPSTQAG PALDPFARVA ALPGVAEAVT TARSAVDTLL RHRVLRRQSA EVTAEASLRS        60
     ARASAALEGH DLGLETLRAR LTAGESAAQG GDELAVTLGA VRLYAELGSL AGAWERAPRQ       120
     ALARMHTLLG RGIVPDGELG RPRADASAAD PLGLGTPPGP AEVSARLDGL VGLLVEKTTA       180
     PAIVVSAIVH GELLALRPFG SLDGMIGRAA ARLVLIGRGL DPKAVTATDV GHLEAGVDGD       240
     GVADYRTAAA GYVHGGADGL RAWLLHCARA TELGARESLA VCEAISRAAS                  290
//

If you have problems or comments...

PBIL Back to PBIL home page